2J7T


Conserved Protein Domain Family
STKc_STK10

?
cd06644: STKc_STK10 
Click on image for an interactive view with Cn3D
Catalytic domain of the Serine/Threonine Kinase, STK10 (also called Lymphocyte-Oriented Kinase or LOK)
STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. STK10/LOK is also called polo-like kinase kinase 1 in Xenopus (xPlkk1). It is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.
Statistics
?
PSSM-Id: 132975
View PSSM: cd06644
Aligned: 4 rows
Threshold Bit Score: 632.837
Threshold Setting Gi: 32766285
Created: 15-Nov-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:ATP binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                        #####   #            # #               #            #        
2J7T_A      8 YEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIETKsEEELEDYIVEIEILATCdHPYIVKLLGAYYh 87   human
AAH70834   23 YEHVRRDLDPNQVWEIIGELGDGAFGKVYKAKNRETGILAAAKVIDTKnEEELEDYMVEIEILATCnHHFIVKLLGAFYw 102  African clawed frog
AAH55124   24 YNHLQRDVNPNDMWEIIGELGDGAFGKVYKAQNKETGVLAAAKVIETKsEEELEDYMVEIDILASCnHQYIVKLLDAFFf 103  zebrafish
XP_414529  23 YEHVRRDLDPGEVWEVVGELGDGAFGKVYKAKNKETGALAAAKVIETKnEDELEDYMVEIEILATCdHPHIVKLLGAFYw 102  chicken
Feature 1          # ####  ##  #                                        ## #         ##       
2J7T_A     88 dgKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTleGDIRLADFGVSAKN 167  human
AAH70834  103 egKLWIMIEFCPGGAVDAVMLELDRGLKEPEIKTICRQMLEALAYLHSMKIIHRDLKAGNVLLTldGEIKLADFGVSAKN 182  African clawed frog
AAH55124  104 dnKLSIMIEFCPGGAVDAIMLELDRGLQEPQIRVICKQMLEALQYLHSMKIIHRDLKAGNILLTldGDIKLADFGVSAKN 183  zebrafish
XP_414529 103 egKLWIMIEFCPGGAVDATMLELDRGLTEPQIQVICRQMLEALHYLHSKKIIHRDLKAGNVLLTqdGDIKLADFGVSAKN 182  chicken
Feature 1                                                                                     
2J7T_A    168 LKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSK 247  human
AAH70834  183 VKTLQRRDSFIGTPYWMAPEVVMCETMKDSPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSEPPTLSSPSK 262  African clawed frog
AAH55124  184 TKTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQIEPPHHELNPMRVLLKIAKSEPPGLDQPSK 263  zebrafish
XP_414529 183 VKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLSCPSK 262  chicken
Feature 1                                                         
2J7T_A    248 WSVEFRDFLKIALDKNPETRPSAAQLLEHPFVssitsNKALRELVAEAKAEV 299  human
AAH70834  263 WSPEFHDFLKTALDKHPETRPSAVQLLEHPFVkk-vsVKPLRELVAEAKAEV 313  African clawed frog
AAH55124  264 WSMDFNDFLKKALDRHPETRPTAAQLLEHPFVssvntNRPLRELVAEAKAEV 315  zebrafish
XP_414529 263 WSLEFRDFLKTALDKNPETRPSAAQLLEHPFVskvtsNRALRELVAEAKAEV 314  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap