Conserved Protein Domain Family
GH20_chitobiase-like_1

?
cd06570: GH20_chitobiase-like_1 
A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
Statistics
?
PSSM-Id: 119338
View PSSM: cd06570
Aligned: 9 rows
Threshold Bit Score: 531.602
Threshold Setting Gi: 37676801
Created: 22-Aug-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active site
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #                                                                    
YP_129481    166 FPWRGALIDTSRHFIPVDVIKRQIDGLASAKFNTFHWHLTDDQGWRIESLAYPNLHekgsdGLYYTREQMKDVVAYAKNL 245 Photobacterium ...
ZP_01053318  132 FVWRGLMIDVSRHFQPIDVIKRNLEAMASVKMNVFHWHLTDDQGFRIESKVYPKLQefasdGLFYTQNQIKDVVAFANNL 211 Polaribacter do...
YP_191014    170 FAWRGLLMDVSRHFDTVETIERQLDAMELVKLNVLHWHLSDGAGFRVESRMFPKLQtvashGQYYTQAQIREVVAYAADR 249 Gluconobacter o...
NP_937197    165 FKWRGVSYDTARHYIELPVILRQLDAMASAKMNVFHWHIWDDQGIRIQLENYPRLWqatadGDFYSKDEIRQVVEYARNL 244 Vibrio vulnific...
ZP_01134142  156 YPWRGLLFDGVRHFLPIDDVKRTLRGLASAKFNVFHWHLTDDQGWRIELNSYPKLHqtasdGLYYTQAQIKEVVAYAAQL 235 Pseudoalteromon...
YP_827776    155 FPWRGLMLDSARHFMPLAVVKRNLDAMAAVKLNVFHWHLSEDQGFRVESKRYPKLQekgsdGLFYTQSEIRDIVSYARDR 234 Solibacter usit...
YP_001817893 163 FPWRGLMIDVCRHWQPMEVLKRNLDGMALVKLNVLHLHLTEDQGFRIESKTHPRLHelgsdGLYFTQDQIREIIAYAAAR 242 Opitutus terrae...
YP_001980874 158 FIWRGLLLDSSRHFFSVASIKRQLDIMAAAKFNLFHWHLTDDQGWRLESKKFPRLQqfasdGQYYTREQVRDIVAYARDR 237 Cellvibrio japo...
YP_591810    167 FPWRGLLIDSGHRFVPVAAVKRNLDGMEAVKLNVLHWRFADDQGFHIESKKLPLLQqkasgGLYYTQEEVREVIAYARDR 246 Acidobacteria b...
Feature 1                    #                                                                ## 
YP_129481    246 GIRVIPEVDLPGHASAIAAAYPELmtevkeykie--rkwgvheplLDPTKPEVYTFIDKIIGEVAELFpDEYIHIGGDEV 323 Photobacterium ...
ZP_01053318  212 GIRVIPEIDVPGHASAILTAYPELgskdnytysi-erfagvfdptLDPSKEITYTFLENLFTEITPLFpDEYFHIGGDEN 290 Polaribacter do...
YP_191014    250 GIRVVPEIDVPGHALAILQAYPELaaqplpdvta--kglnlnnaaLDPTNPQTLRFVRVLYGEMGGLFpDRYVHTGGDEV 327 Gluconobacter o...
NP_937197    245 GIRVIPEISLPGHASAVAHAYPELmsglgeqsypqqrgwgvfeplMDPTNPELYTMLASVFDEVVELFpDEYFHIGGDEP 324 Vibrio vulnific...
ZP_01134142  236 GIRVVPEFDVPGHASAIILAYPELgsgtvlseme--rhwgvfkplLDPSNPKVYLFVDEVVDELAGLFpDPYLHIGGDEV 313 Pseudoalteromon...
YP_827776    235 GIRVVPEFDIPGHTTAWMVGYPELgtvpgpyeig--rkwgvyenaLDPSREETYTFLDNFFEEITPLFaDLYFHIGGDEV 312 Solibacter usit...
YP_001817893 243 GIRVVPEFDMPGHATSWAVAYPELasapgpyvie--rgwgifdpvLDPTNEKVYALLEDFLGEMAALFpDPYLHIGGDEN 320 Opitutus terrae...
YP_001980874 238 GIHVLPEIDIPGHASAIAVAYPELmsapgpyame--yrwgvhkptLNPANERVYEFVDQLIAEVVELFpFDYVHIGGDEV 315 Cellvibrio japo...
YP_591810    247 GIRVMPEFDMPCHTRSWFLAYPELasrga-----------adsagFDPSKESTYKLLATFIGEMAALFpDAYFHTGGDEC 315 Acidobacteria b...
Feature 1                                                       #                #               
YP_129481    324 npkqWNESKAVQTFMAEKGLkdaLELHAFFNQEVEEILKKhdrKMIGWDEtyhpdlpksIVIQSWRgh-------dsLGE 396 Photobacterium ...
ZP_01053318  291 egkhWSENEEIKKFKEKHQLknnHELQTHFNIRLEKILNKlgkKLMGWDEiltpnmpttAVIHSWRgenegvanggsLIE 370 Polaribacter do...
YP_191014    328 vssqWTKNPAIAAYMKAHGFetaAALQAAFTGEVAKIISAqghVMMGWDEvseapipknVVVEPWRas-------kwTGT 400 Gluconobacter o...
NP_937197    325 nyqqWRDNPKIQAFIKQHQLdgeRGLQSYLNSRVEQMLNQrgkKITGWDEiwhkdlpksVVIQSWQgh-------dsIGR 397 Vibrio vulnific...
ZP_01134142  314 ddsdWQTNSQIQAYMQTNNLsdsYALHAYFNQRVATILAKyhkKMIGWDEvlhpslpknTLVQSWRgh-------hsLTA 386 Pseudoalteromon...
YP_827776    313 varqWNASARVQAWAKEHNLkdaHAIQAYFNTRVQKLLQKrgkVLIGWDEvlhpdlpkdIVVQSWRgq-------ksLAE 385 Solibacter usit...
YP_001817893 321 ngkhWNANARIQAFIREHDLkdnEGLHATFNRRVRDILTKhgkKMVGWDEilhpdlpqdAIVHSWRgp-------tgLAA 393 Opitutus terrae...
YP_001980874 316 dpqhWQENADIQAFMQANGLvdhLALQAYFNQRVQKILSQhkrNMIGWDEiqhpdlpnnIVIHSWQgp-------dgVSN 388 Cellvibrio japo...
YP_591810    316 dpkeWESNPRIAQYMREHKFangAALQAMFTGRVEKIVAAnkkIMVGWDEvlqpntpkdVVIQSWRgq-------asLAD 388 Acidobacteria b...
Feature 1                      # #                                                               
YP_129481    397 SANDGYQGILSTGyYIDQAqpAAMHYRNDPMpkplqvddevhtdeswetwqfeaprkrgsavtgtftlitakdgtrrgfi 476 Photobacterium ...
ZP_01053318  371 AAKKGYQTVLSNGfYIDRMlsVEHHYAVDPIgdikls------------------------------------------- 407 Polaribacter do...
YP_191014    401 ATQAGHPVVVSAGyYLDLLrpSAAHYAVDPFdtkaegitaeqlakyppkhpe---------------------------- 452 Gluconobacter o...
NP_937197    398 AAKEGYQGILSTGyYLDQPqpTSYHYRNDPMpkgitvddqlhqgekfvtydwvkprnkggprkgnltiiegadgkvraft 477 Vibrio vulnific...
ZP_01134142  387 IREAGFDGLLSSGfYIDQPqwTSYHYRNHPVpaptkkvvahklkgsvnftltrlkgspvtgqvdvftnhhnaifarveik 466 Pseudoalteromon...
YP_827776    386 AATKGYRGILSWGyYLDHLspAKFHYGVDPMssdadkl------------------------------------------ 423 Solibacter usit...
YP_001817893 394 AAKAGHAAILSNGyYIDLCysAADHYRNDPLpadtaip------------------------------------------ 431 Opitutus terrae...
YP_001980874 389 AIRHGFNAILSTGyYLDQPqtAAYHYRQDPLpqppfridapavgeswqswsftlprqrgrpvsgsftllddgkqtrgfid 468 Cellvibrio japo...
YP_591810    389 AAREGYRGVLSWGyYIDLNqsAAEHYQVDPMgdaaakl------------------------------------------ 426 Acidobacteria b...
Feature 1                                                                                        
YP_129481    477 dyksrsrravfdiettqgi-----tsfwmdswmgqtkprvelqggkltghmvvgnaqyvmtgqkiagndiqnsqyptapy 551 Photobacterium ...
ZP_01053318      --------------------------------------------------------------------------------     Polaribacter do...
YP_191014    453 ----------------------------------------------------------------------fsvpfamdeh 462 Gluconobacter o...
NP_937197    478 dyngksreevyvleyvpgvmfrghfdnfmsytefnyqfagdqlkegsyqrignvrwpatgnlvassegevtsipqpnggy 557 Vibrio vulnific...
ZP_01134142  467 gkgqfishnvkqtag-------------vyqitldtwmgpttlrfalgqnsqldaligntpytfaaqanttslehlntll 533 Pseudoalteromon...
YP_827776        --------------------------------------------------------------------------------     Solibacter usit...
YP_001817893     --------------------------------------------------------------------------------     Opitutus terrae...
YP_001980874 469 fagksrrevkvhrytknr------aqfsldtwmgpvefdvnmdqrlggkawvgnvaypvsgkqiagsnhaqtglpepqva 542 Cellvibrio japo...
YP_591810        --------------------------------------------------------------------------------     Acidobacteria b...
Feature 1                           # #                                      
YP_129481    552 pvalkkeqehlILGGEVTLWAEnvkdDTIDLRMWPRSYVIAERLWSaetitDENSMYERM 611 Photobacterium profundum SS9
ZP_01053318  408 -----keelskILGGEATMWSElvtpQTIDSRIWPRTAAIAERLWStkdvkDIDNMKKRL 462 Polaribacter dokdonensis MED152
YP_191014    463 applddgqkalVMGAEGTLWAEmvsePMLDGRLWPRMAALAERFWSaqdvrDVPDLERRL 522 Gluconobacter oxydans 621H
NP_937197    558 paqltkeeeplILGGEVTIWGEnldsMTIEQRLWPRSYAIAERLWSsesltDEASMYRRM 617 Vibrio vulnificus YJ016
ZP_01134142  534 iaeqqreqtgnVLGGEATIWSElittENLDTRLWPRLYAIAERFWSspsltNERDMYQRL 593 Pseudoalteromonas tunicata D2
YP_827776    424 ----apeqasrILGGEACMWAEyttsETVDSRIWPRAAVIAERLWSpaatvDVESMYTRM 479 Solibacter usitatus Ellin6076
YP_001817893 432 -----laeqsrILGGEATMWAEwvspETIDSRIWPRTAAIAERLWSprdvnDVADMYRRL 486 Opitutus terrae PB90-1
YP_001980874 543 pyvlraedyarVLGGEVALWSElvdeGTLDLRLWPRALAVAERLWSaqdrrDEVDLYQRL 602 Cellvibrio japonicus Ueda107
YP_591810    427 ----tpeqqarILGGEATMWTDivshENMDNRIWPRTAAIAERFWSpqevrDLDSMYARL 482 Acidobacteria bacterium Ellin345

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap