1FC7,1N6E,1J7X,3DJA


Conserved Protein Domain Family
Peptidase_S41

?
cd06567: Peptidase_S41 
Click on image for an interactive view with Cn3D
C-terminal processing peptidase family S41
Peptidase family S41 (C-terminal processing peptidase or CTPase family) contains very different subfamilies; it includes photosystem II D1 C-terminal processing protease (CTPase), interphotoreceptor retinoid-binding protein IRBP and tricorn protease (TRI). CTPase and TRI both contain the PDZ domain while IRBP, although being very similar to the tail-specific protease domain, lacks the PDZ insertion domain and hydrolytic activity. These serine proteases have distinctly different active sites: in CTPase, the active site consists of a serine/lysine catalytic dyad while in tricorn core protease, it is a tetrad (serine, histidine, serine, glutamate). CPases with different substrate specificities in different species include processing of D1 protein of the photosystem II reaction center in higher plants and cleavage of a peptide of 11 residues from the precursor form of penicillin-binding protein; and others such as tricorn protease (TRI) act as a carboxypeptidase, involved in the degradation of proteasomal products. CTPase homolog IRBP, secreted by photoreceptors into the interphotoreceptor matrix, having arisen in the early evolution of the vertebrate eye, promotes the release of all-trans retinol from photoreceptors and facilitates its delivery to the retinal pigment epithelium.
Statistics
?
PSSM-Id: 143475
View PSSM: cd06567
Aligned: 491 rows
Threshold Bit Score: 84.269
Threshold Setting Gi: 188587087
Created: 8-Jan-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Active site
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:Active site serine [active site]
Evidence:
  • Structure:1FC7: Scenedesmus obliquus Photosystem II D1 C-terminal processing protease (D1P)
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
1FC7_A         9 FLEAWRAVDRayvdks------fngqsWFKLRETylkke-pmdrRAQTYDAIRKLLavlddpFTRFLEpsrlaalrrgta 81  Scenedesmus obl...
ZP_01856613  228 FDKVWNAFDReyamfv-----ikpevdWQKLRDQfrpqavlaknNRELANVLSEMLahlkdlHVYVQVdgtyvkgfnrer 302 Planctomyces ma...
YP_002760585  46 FDALWTRFDDvypsfa------ykrvdWNAQRARyrpraerarsQDELVAVLIEMLaplhdrHVWLVDprgqavptyran 119 Gemmatimonas au...
ZP_01105250  358 LFKYWNIVNYfspnkh------ltdknWDEVLTEyipkfidsknELEYELTTLKLIgeisdsHARIGLggqkindlrgny 431 Flavobacteriale...
YP_001095926 354 LYRYWNIVQYffpyky------ltdkeWSGVLAEylplflgaknRLDYEKVTLSLIaelkdtHANLWAgrgevekmrgef 427 Shewanella loih...
ZP_02162210  359 LYRYWNMIHYyfpyky------ltdkdWSTVLKEyiptfinastELEYEIAALRLIgdiqdtHAGLWGgndkfqailgsn 432 Kordia algicida...
YP_822875    357 LFRYWNIIEYwfpnrd------iigenWDDVLKQtlpkivlakdRDTYQLEMMALIarihdsHANLWSslalrppvgacq 430 Solibacter usit...
NP_905749     36 YDALWEILDRgycffdlklpedstwrdMYHKHYRdlhp---qmsSDSLFLVMTQLLselkdgHVNLSSsfdyghywkwye 112 Porphyromonas g...
YP_001304522  33 FEALWKILDEnycffey----kdidwnEVHDRYKtqis--dtmnQYVLFDVLGDMLnelkdgHTNLIStfnmsrywdwyl 106 Parabacteroides...
YP_679924     37 FEYLWKQCDEkysffei----nnidwnAIHDTYRaqit--dgmsKEDQFIVMGNMLnelkdgHVNLLSdfnisdyhfdwk 110 Cytophaga hutch...
Feature 1                                                                                        
1FC7_A        82 gsvtgvgleitydggsgkdvvvltpapggpaekagaragdvivtvdgtavkgls---------lydvsdllqgeadsqve 152 Scenedesmus obl...
ZP_01856613  303 qfnaspaaa----------------------------------------------------------------------- 311 Planctomyces ma...
YP_002760585 120 altnfdrarw---------------------------------------------------------------------- 129 Gemmatimonas au...
ZP_01105250  432 yppfevrfiqgklvvtnyhnpelikesgleigdvithiqeravesvidslkpyyp-------asndaarmrdisldilrs 504 Flavobacteriale...
YP_001095926 428 yppvftrfvegelvvvdfytdnesnisdmsrlgglsigdviteidgvaveklvkdklryypasneasrlrdiapdllrsn 507 Shewanella loih...
ZP_02162210  433 tapfkvafvenklvvtkyynpeykevskvkigdvithingktveeikkerhdy----------hpasneptkdrnmaksm 502 Kordia algicida...
YP_822875    431 lpvnlrfvenqavvtgysaeamentsglkvgdviadldgvpvaklvqtwtpyya---------asneptrlrdiarsmtr 501 Solibacter usit...
NP_905749    113 dyplnlsldlrrky------------------------------------------------------------------ 126 Porphyromonas g...
YP_001304522 107 dypdnfdsdiq--------------------------------------------------------------------- 117 Parabacteroides...
YP_679924    111 gpqnitprvvye-------------------------------------------------------------------- 122 Cytophaga hutch...
Feature 1                                                                                        
1FC7_A       153 vvlhapgapsntrtlqltrqkvtinpvtfttcsnvaaaalppgaakqqLGYVRLatfn-----sntTAAAQQAFTelskq 227 Scenedesmus obl...
ZP_01856613  312 ---------------------------ahligkinqvkgmrwgrteddIGYIAVdslsketllnqfESALKQMQGt---- 360 Planctomyces ma...
YP_002760585 130 --------------------------eaamrdasivrrneigeglvggYAYLYIgtwrapvdidalDLALERARDa---- 179 Gemmatimonas au...
ZP_01105250  505 reknlsigyisedkkiqeviklfpkdsldivrwdvsdgkpshkfiddnIGYITLrsle----kkdiENIKTKFRNt---- 576 Flavobacteriale...
YP_001095926 508 kaeidisfrrdklmgntslklfkkdeldyfylyrkpkgeksyknidgdIGYVTLatie----kedvDSIKNQFKDa---- 579 Shewanella loih...
ZP_02162210  503 lrspnkeiaityvsdgktqqhtlplygfrdlniyaksnkasyklldnnIGYVTLetis----vddiSKIKKQFKKt---- 574 Kordia algicida...
YP_822875    502 gecgaaklrvfrgtqevtlqsdrvplgslkfssshdrpgetyqrlsseVAYIKMssik----nvdiPRYIDSAAGt---- 573 Solibacter usit...
NP_905749    127 -----------------------lghdyriagglkyrrltynghapdsIGYIVYesfgkp-isnsnISGMLSRLTec--- 179 Porphyromonas g...
YP_001304522 118 -------------------------enylgrnysiagglkyttlsdgqIGYIYYgsfsss-agesgLDHIFYQFKdc--- 168 Parabacteroides...
YP_679924    123 -------------------------hyigqdgylnspfqhnfvgggtdVGYIIFstfpgt-mtddqIDFILNRYKdt--- 173 Cytophaga hutch...
Feature 1                                                                                        
1FC7_A       228 gvaGLVLDIRn--NGGGlf----paGVNVARMLvdrgdlvliadsqgi----------rdiysadgnsidsatPLVVLVN 291 Scenedesmus obl...
ZP_01856613  361 --rGLVLDIRa--NGGGaeplgqkmAGYFLDQPclyathqyrsgpkhddlg-----smqkrrlipsqdwyyrgPVIVLQG 431 Planctomyces ma...
YP_002760585 180 --qGLIIDLRt--NAGGsd----gtAMAFAGRFtrrafpasyveirtdprvtd-vemplartiaprgpwqftrPVVLITG 250 Gemmatimonas au...
ZP_01105250  577 --kGIIIDIRnypNTFVpy----slGPYFVSSTrpfvkltaanidnpgei------cfvkelevpksndaysgKLIVLVN 644 Flavobacteriale...
YP_001095926 580 --aGIIIDIRnypNTPSmy----slGSFFVEDKsafakftypninnpgef------gvgnvavlkpsevtfkgKLVVLVN 647 Shewanella loih...
ZP_02162210  575 --kGIIIDIRn--YPAEsil--yylGSYFVSEPtefvkfsrmneknpgef------vmteayeisksrsmykgKLVVLVN 642 Kordia algicida...
YP_822875    574 --kGLIIDIRn--YPSDfvv--ftlGQLLVTEKtefvrftsgdlanpgaf------hwgpplalnpqkphyagKVVILVD 641 Solibacter usit...
NP_905749    180 --kALIIDIRg--NGGGql----tyADEFARHFtkekmltgyirhktgpahdafsdplplyldtlssgvvwmrPVVLLTN 251 Porphyromonas g...
YP_001304522 169 --kGLIFDIRd--NGGGml----snADRIASRFleekiltgyiqhktgkghdd-fsepyplylspserirwlrPVVVLTN 239 Parabacteroides...
YP_679924    174 --kGLIIDVRq--NGGGaa----tdMTRLVSHFmgsestvyrtrikegkghnd-ftaledikikpsdgtkytkPVYLLTD 244 Cytophaga hutch...
Feature 1            #                                                                       
1FC7_A       292 rgtaSASEVLAGALKDskRGLIAGERTFGKGliQTVVDls-dGSGVAVt-vARYQTPagvdinkiGVSPD--VQLD 363 Scenedesmus obliquus
ZP_01856613  432 ektmSSAEAFALMLAEcpTVTTMGDRTAGSSg-NPRRIdagaGIIVNLp-rWIAYDAagkpfdtvGVQPD--IRVK 503 Planctomyces maris ...
YP_002760585 251 rgglSATESFAAAMRTlpQVTVIGDTTGGASg-NPATFalgnGWQFTVp-rWLEYGPdrqpiegrGVAPH--LAMA 322 Gemmatimonas aurant...
ZP_01105250  645 eysqSQSEFTCMALRVgdNTTIVGSTTAGADg-NVSSIslpgGISTRIs-gMGIYYPdgtetqrvGIEPD--VESK 716 Flavobacteriales ba...
YP_001095926 648 entqSQAEFTAMAFRAgrDTTIIGSKTSGADg-NMVRLdl-pGGLRTAfsgLGVYYPdggetqrvGIIPD--IEVR 719 Shewanella loihica ...
ZP_02162210  643 easqSHAEFTAMAFRAgeNTTIVGSTTAGADg-NVSTImlpgGLRTSIs-gIGVYYPdggetqriGIVPD--VEVK 714 Kordia algicida OT-1
YP_822875    642 evsqSNAEYTTMAFRSatGATVIGSTTAGADg-NVSQIpl-pGGLSTMisgIGVFYPdkrptqrvGIVPD--IEVK 713 Solibacter usitatus...
NP_905749    252 revfSSANDFVLKMRSlpFVTVMGDKTGGGAglPISSEip-cGWGVRYs-aGRMTDPsgad-vefGIEPHyyVSLL 324 Porphyromonas gingi...
YP_001304522 240 rhcySAANDFVQKVRMmpYVTTMGDRTGGGSgfPFNSElp-nGWGVRFs-aSPMLDVnkqh-tefGIDPT--YKVS 310 Parabacteroides dis...
YP_679924    245 rgtfSSGSFFTTAMRSlpHVTVMGDTTGGGMglPNGGQlp-nGWTYRFs-vTQTWDMdgnl-yenGIPPDv-LKFI 316 Cytophaga hutchinso...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap