Conserved Protein Domain Family

cd06564: GH20_DspB_LnbB-like 
Click on image for an interactive view with Cn3D
Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
PSSM-Id: 119334
Aligned: 34 rows
Threshold Bit Score: 217.539
Threshold Setting Gi: 123438499
Created: 15-Nov-2005
Updated: 2-Oct-2020
Aligned Rows:
active site
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
  • Structure:1YHT_A; Aggregatibacter actinomycetemcomitans dispersin B binds glycerol and acetic acid.
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                   #                            #                                        
1YHT_A         17 KQTGLMLDIARHFYSPEVIKSFIDTISLSGGNFLHLHFSDh--eNYAIESHLLNQRaenavqgkdg-------------- 80   Aggregatibact...
NP_267650       1 MEKGLLVDIGRKYWSIAELKRLVLLLQEHKLTHLQLHLNEn--eGFALNFTDSPVSk----------------------- 55   Lactococcus l...
CAD55218      178 PKRGFSLDIARKHYSADWIKDRIRELGDLKFNELGLHFSDd--qAFRIESDSHPEIvs---------------------- 233  Streptomyces ...
ZP_02034613    43 FDRIVHLDMGRKYFTPDWIKSLIDEMAKLGYNQLELDFGNsekgQLRFALEDMSVNytyteqtmvpvdntdaqeepaapv 122  Bacteroides c...
NP_357651     631 KNKVISIDAGRKYFTLDQLKRIVDKASELGYSDVHLLLGNd---GLRFLLNDMTITangktyasddvkkai--------- 698  Streptococcus...
NP_813917     491 LKSVFSIDAGRKYFSVEQLEELVAKASQNGYTDVQLILGNd---GLRFILDDMSVNvngkkynhnrvskai--------- 558  Enterococcus ...
NP_357651     186 KKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNd---GLRFMLDDMSITangktyasddvkrai--------- 253  Streptococcus...
BAF44566       37 LKSVFSIDAGRKFFSADQLKMIIDRAHTDGYTDVQVLLGNd---ALRLLLDDMSVTingktygsdvvkqai--------- 104  Lactobacillus...
ZP_02076376    62 LKSVFSIDAGRKYFSTEQLKTIIERAYKNGYTDVQILLGNd---ALRFFLDDMSLEvngkqydsnavkeal--------- 129  Eubacterium d...
XP_001310032   21 TRNAFMLDVARRKMTKDQILQAINSINITCFRYLMLHLSDdqsySLGFITDTLKIGkqti-------------------- 80   Trichomonas v...
Feature 1                                                                                         
1YHT_A            --------------------------------------------------------------------------------      Aggregatibact...
NP_267650         --------------------------------------------------------------------------------      Lactococcus l...
CAD55218          --------------------------------------------------------------------------------      Streptomyces ...
ZP_02034613   123 etgepveeqpaapvqteepadeeqtaetvmplqeepaapaetvaptapvtdevleqaeesgaangvivynyidvpttktv 202  Bacteroides c...
NP_357651     699 -----------------------------------------------------------------------------ieg 701  Streptococcus...
NP_813917     559 -----------------------------------------------------------------------------qrg 561  Enterococcus ...
NP_357651     254 -----------------------------------------------------------------------------ekg 256  Streptococcus...
BAF44566      105 -----------------------------------------------------------------------------qag 107  Lactobacillus...
ZP_02076376   130 -----------------------------------------------------------------------------tkg 132  Eubacterium d...
XP_001310032      --------------------------------------------------------------------------------      Trichomonas v...
Feature 1                                                 #                                       
1YHT_A         81 -iyinpytgkpFLSYRQLDDIKAYAKAKGIELIPELDSPNHMTAIFKLVqkdrgvkylqglksrqvddeIDITNADSITF 159  Aggregatibact...
NP_267650      56 -----------KYSENMLKELKEFAKTHEITLIPDFDSPGHMGSLLEQNpefalp--------dsnqqaVDVTNPAVIDW 116  Lactococcus l...
CAD55218      234 ---------deHLTKAEMKEIIDLAASRHITVVPEIDSPGHLGAVIAAHpdlqlrna----qgtatrgaIDISKPEAAKI 300  Streptomyces ...
ZP_02034613   203 ylnaalpadgeYITESEMKGIIAHAKDKGIEIVPLLNSPGHFGAVLDGVrdengapvn---fsynnsnsLDITNEEAVAF 279  Bacteroides c...
NP_357651     702 tkayyddpngtALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAMeklgiknpqa-hfdkvskttMDLKNEEAMNF 780  Streptococcus...
NP_813917     562 nnayyndpngnALTQKEMDRLLAFAKARNINIIPVINSPGHMDALLVAMeklaiknp----afdgskrtVDLGNQKAVNF 637  Enterococcus ...
NP_357651     257 tndyyndpngnHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMkelgiqnpnfsyfgkksartVDLDNEQAVAF 336  Streptococcus...
BAF44566      108 nkayyddpngnALTQTDMDAVLKYAAARDINIIPVINSPGHMDAILTAMaqlgiknp----afngskrtVDLNNDTAIAF 183  Lactobacillus...
ZP_02076376   133 nqsyyndpngnALTQAEMDEILAYAAERGMNIIPVINSPGHMDSILVAMetlgiqnp----qfdgsvrtVDLDNEEAVAF 208  Eubacterium d...
XP_001310032   81 --------gngWLTDSDLAEIVSLAKSKSLYLIPDIDAPSHVGSWYKSYqssgestd-----ifsdsntLDIEKLDSSSG 147  Trichomonas v...
Feature 1                                 ##                                                      
1YHT_A        160 MQSLMSEVIDIFgd-tsQHFHIGGDEFgys-----------------------vesNHEFITYANKLSYFLEKkGLKTRM 215  Aggregatibact...
NP_267650     117 IMGIIDKIVDIFpd--sDTFHIGADEFidfrqiekypylv---ektrekygnkasgLEFYYDYVNQLTEHLQKkGKQVRI 191  Lactococcus l...
CAD55218      301 VDDLLNEYADLFp---gSQFHLGADEYqalvvpnpeasyptlaaaarkaygsggtvADLTTGWLNGRAKTVMAhDRTPRA 377  Streptomyces ...
ZP_02034613   280 GQAVVLKYAEWFkgqgcDTFNIGADEFandiypsggm---------gfghlvwtqqYHHFVDYVNTLADKLQEmGYTVRA 350  Bacteroides c...
NP_357651     781 VKALIGKYMDFFag-ktKIFNFGTDEYandatsaqg-----------wyylkwyqlYGKFAEYANTLAAMAKErGLQPMA 848  Streptococcus...
NP_813917     638 TKAIISKYVAYFsa-hsEIFNFGGDEYandvdtggw------------aklqssgrYKDFVAYANDLAKIIKDaGMQPMS 704  Enterococcus ...
NP_357651     337 TKALIDKYAAYFak-ktEIFNIGLDEYandatdakgwsvlq-adkyypnegypvkgYEKFIAYANDLARIVKShGLKPMA 414  Streptococcus...
BAF44566      184 TKALLQKYVMYFkg-haTIFNFGSDEYandvdtggw------------aklqqsgtYKKFVAYVNDLAAMAKNaSLKPMV 250  Lactobacillus...
ZP_02076376   209 TKALVKKYAEYFgsksvEIFNLGCDEYandkntggw------------anlqksglYKKFVAYVNDLSAIVKAaGMKPMC 276  Eubacterium d...
XP_001310032  148 VYEIYKKCMTIFkd-vsNYINIGVDEVpgn-----------------------tyyANQLASHINKINQIAKEnNYKTVV 203  Trichomonas v...
Feature 1         #                       #                                        #              
1YHT_A        216 WNDGLIknt---feqINPNIEITYWSydgdtqdkneaaerrdmrvsLPELLAKGFTVLNYNSYYLYIVpkasptfsqdaa 292  Aggregatibact...
NP_267650     192 WNDGFLrkdlqslvpLNKNVEVCYWTnwdk------------gmaeVKEWLTKGYTLINFCDNDLYYVlgee----agys 255  Lactococcus l...
CAD55218      378 WNDGFFkdt---svePLKDIKVAYWTgkei------------garpPAEYLGEGRQVLNYNDEFLYYVlgqpq---tfvy 439  Streptomyces ...
ZP_02034613   351 FNDGINygg---qtgVENDIQVCYWTsgwpg----------ynvasASALAAQGFTMINTHGDYYYVLgkns-----amt 412  Bacteroides c...
NP_357651     849 FNDGFYyedk-ddvqFDKDVLISYWSkgwwg----------ynlasPQYLASKGYKFLNTNGDWYYVIgnhk----qdea 913  Streptococcus...
NP_813917     705 FNDGIYynsddsfgtFDPEIIISYWTagwsg----------ydvakPEYFVQKGHKIFNTNDAWYWVAgnvd-----sgi 769  Enterococcus ...
NP_357651     415 FNDGIYynsdtsfgsFDKDIIVSMWTggwgg----------ydvasSKLLAEKGHQILNTNDAWCYVLgrna----dgqg 480  Streptococcus...
BAF44566      251 FNDGIYydnntsfgtFDKDLIVSYWTagwgg----------ydvakPEFLTDKGLKIMNTNDGWYWVLgrvd-----gdl 315  Lactobacillus...
ZP_02076376   277 FNDGIYynskeefgtFDKDLIISYWTsgwwg----------ydvakPSFFAERGHKILNTNDGWYWVIgnydk--sehgn 344  Eubacterium d...
XP_001310032  204 WNDALNgkl---lqqLDSDITIMYWHdsd--------------vntFEALLNTKNPIKNAYYDTNYDNvhdl----depe 262  Trichomonas v...
Feature 1                                              # #                            
1YHT_A        293 FAAKDVIKNwdlgvwdgrntknrvqntheIAGAALSIWGEdakalkdETIQKNTKSLLEAVIHKTNGD 360  Aggregatibacter actinomyc...
NP_267650     256 YPTAEKLERegkiqkfsgqqylnqeemkaVRGTYFSIWADnaaaksvSEILDDLSKVLPVFMKIYGGN 323  Lactococcus lactis subsp....
CAD55218      440 PTGERIYEQwtprvlrgtt-avdakyddqILGGSFAVWGDfpnaqtqAQVAEGIRLPLAATVQKLWDP 506  Streptomyces coelicolor A...
ZP_02034613   413 EGKIDAADFdaasfid-------gsviaePAGAMFCIWSDypdaqtqDEVMNGALPYMTGFASALGGG 473  Bacteroides capillosus AT...
NP_357651     914 YPLSKAVENsgkvpfnqlastkypevdlpTVGSMLSIWADrp---saEYKEEEIFELMTAFADHNKDY 978  Streptococcus pneumoniae R6
NP_813917     770 YQYDDALANmskkaftdv---pagspnlpIIGSIQCVWYDdp---rrDYDFERIYTLMDTFSENYREY 831  Enterococcus faecalis V583
NP_357651     481 WYNLDQGLNgikntpitsv-pktegadipIIGGMVAAWADtp---saRYSPSHLFKLMRHFANANAEY 544  Streptococcus pneumoniae R6
BAF44566      316 YSYKTALASlaskkftdv---pgassavpIIGSVQAVWADdp---saQLDMPALLKLMDQFSTAYAPY 377  Lactobacillus casei
ZP_02076376   345 GYTYDSAVNgikgkdftsvtgakpednldLIGSMQAVWCDyp---eeVYEEDVVLGLMDLFSETHSEY 409  Eubacterium dolichum DSM ...
XP_001310032  263 YQKGKITKFvn----------------nlINNNILCLWGEdse-ditHDQIINFINDVQNEMIKNNKI 313  Trichomonas vaginalis G3

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap