1F8I,1DQU,1OY0,1M3U


Conserved Protein Domain Family
ICL_KPHMT

?
cd06556: ICL_KPHMT 
Click on image for an interactive view with Cn3D
Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds. Typical members are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate hydrolase (PPH), carboxyPEP mutase (CPEP mutase), oxaloacetate hydrolase (OAH), isocitrate lyase (ICL), 2-methylisocitrate lyase (MICL), and ketopantoate hydroxymethyltransferase (KPHMT).
Statistics
?
PSSM-Id: 119341
View PSSM: cd06556
Aligned: 4 rows
Threshold Bit Score: 217.481
Threshold Setting Gi: 8569614
Created: 13-Jun-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                          # ###              #                       
1F8I_A     57 LWEQLhd----lEWVNALGALTGNMAVQQVRaGLKAIYLSGWQVAGDanlsghtYPDqSLYPaNSVPQVVRRINNAlqra 132 Mycobacterium tube...
1DQU_A     59 LWGILernfknkEASFTYGCLDPTMVTQMAK-YLDTVYVSGWQSSSTasstdepSPDlADYPmNTVPNKVNHLWMAqlfh 137 Aspergillus nidulans
1OY0_A     23 THHLQrwk-adgHKWAMLTAYDYSTARIFDEaGIPVLLVGDSAANVVy-----gYDTtVPISiDELIPLVRGVVRGap-- 94  Mycobacterium tube...
1M3U_A      6 ISLLQkyk-qekKRFATITAYDYSFAKLFADeGLNVMLVGDSLGMTVq-----gHDStLPVTvADIAYHTAAVRRGap-- 77  Escherichia coli A...
Feature 1                                   # #                             #                 
1F8I_A    133 dqiaki---------egdtsvenwlAPIVADGEAGFGga--lnVYELQKALIA-AGVAGSHWEDQlasekksghlggkvl 200 Mycobacterium tube...
1DQU_A    138 drkqreermttpkdqrhkvanvdylRPIIADADTGHGgl--taVMKLTKLFVE-RGAAGIHIEDQapgtkkcghmagkvl 214 Aspergillus nidulans
1OY0_A     95 ------------------------hALVVADLPFGSYeagptaALAAATRFLKdGGAHAVKLEGGe-------------- 136 Mycobacterium tube...
1M3U_A     78 ------------------------nCLLLADLPFMAYatp-eqAFENAATVMR-AGANMVKIEGGe-------------- 117 Escherichia coli A...
Feature 1                                 #                                                   
1F8I_A    201 iptqqHIRTLTSARLAAdvadvpTVVIARTDAeaatlitsdvderdqpf------------------------------- 249 Mycobacterium tube...
1DQU_A    215 vpiseHINRLVAIRAQAdimgtdLLAIARTDSeaatlitstidhrdhpfiigstnpdiqplndlmvmaeqagkngaelqa 294 Aspergillus nidulans
1OY0_A    137 ----rVAEQIACLTAAG------IPVMAHIGFtpqsvntlgg-------------------------------------- 168 Mycobacterium tube...
1M3U_A    118 ----wLVETVQMLTERA------VPVCGHLGLtpqsvnifggy------------------------------------- 150 Escherichia coli A...
Feature 1                                                                                     
1F8I_A    250 ----------------------------------------------------------------itgertregfyrtkng 265 Mycobacterium tube...
1DQU_A    295 iedewlakaglklfndavvdainnsplpnkkaaiekyltqskgksnlearaiakeiagtdiyfdweaprtregyyryqgg 374 Aspergillus nidulans
1OY0_A    169 -----------------------------------------------------------------------frvqgrgda 177 Mycobacterium tube...
1M3U_A    151 -----------------------------------------------------------------------kvqgrgdea 159 Escherichia coli A...
Feature 1                          #                           # #                            
1F8I_A    266 iEPCIARAKAYAPF-ADLIWMETgtpdLEAARQFseavkaeypdqMLAYNCSpsfnwkkhlddatiakfqkelaamgFKF 344 Mycobacterium tube...
1DQU_A    375 tQCAINRAVAYAPF-ADLIWMESklpdYKQAKEFadgvhavwpeqKLAYNLSpsfnwkkamprdeqetyikrlgalgYAW 453 Aspergillus nidulans
1OY0_A    178 aEQTIADAIAVAEAgAFAVVMEMv--pAELATQItgk-----ltiPTVGIGAgp----------------------nCDG 228 Mycobacterium tube...
1M3U_A    160 gDQLLSDALALEAAgAQLLVLECv--pVELAKRItea-----laiPVIGIGAgn----------------------vTDG 210 Escherichia coli A...
Feature 1        #                               
1F8I_A    345 QFITlagf---------------halNYSMFDLAY 364 Mycobacterium tuberculosis
1DQU_A    454 QFITlagl---------------httALISDTFAK 473 Aspergillus nidulans
1OY0_A    229 QVLVwqdmagfsgaktarfvkryadvGGELRRAAM 263 Mycobacterium tuberculosis
1M3U_A    211 QILVmhdafgitgghipkfaknflaeTGDIRAAVR 245 Escherichia coli ATCC 8739

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap