Conserved Protein Domain Family
GH18_trifunctional

?
cd06549: GH18_trifunctional 
GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
Statistics
?
PSSM-Id: 119366
View PSSM: cd06549
Aligned: 8 rows
Threshold Bit Score: 345.165
Threshold Setting Gi: 169826146
Created: 5-Aug-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative active
Feature 1:putative active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #                                               #                            
YP_162389      94 LSMAFYtpw------ddaSIASLSRHin---------------dIDWLSPGWLSvtgadhhw------------------ 134  Zymomonas mob...
ZP_01058557   119 EQPVFSama------esaSTPRLYAHlpiayewahlsladecarPSVLVPEWITleveknilsvs--------------- 177  Roseobacter s...
YP_496869      85 LAIGFYqpr------sdaSFQSLSRHgn---------------qLDWVVPALLNvagpehrl------------------ 125  Novosphingobi...
YP_001681863   99 ISVGFYvsw------dedSRESLRRNid---------------kLDVVSPQWVAlkgpagdi------------------ 139  Caulobacter s...
YP_001263244   99 TAYAFHapw------ddaSAASLARHvd---------------dIDWLIPGWISitgpdhkv------------------ 139  Sphingomonas ...
YP_589476      93 IRAAFYvdw------daaSFSSLKQYyp---------------qIDLLFPEFLHvltedghiqgvtaenkl-------fd 144  Acidobacteria...
YP_001696304   13 IALLFItacsnskeppaiAKEELKDKak--------------lrLSMWLPEWQNqsaledvqnsqqglqdmrvfgayfnh 78   Lysinibacillu...
ZP_02117440    90 QALRFAylas-----ndyALASLKQHaa---------------eLDGIIPDWLElrqqegri------------------ 131  Methylobacter...
Feature 1                                                                                        #
YP_162389     135 -------tefpdpqGHAIINNAkqkPKILPMVQNvsngewdgkn-----aailmrdpaARLQFLNNIEKFlvknqADGAV 202  Zymomonas mob...
ZP_01058557   178 ----lasddtrlavTEYVAETEratSLLPVVSLNisgipdhf--------vdllveknSKAAIIASLAETltalsAQGAC 245  Roseobacter s...
YP_496869     126 -------avsndprFDSFVAAGhhhYKVLPMVQNvggdgwdgan-----varilenatERHALERQLADYvarrgDAGLV 193  Novosphingobi...
YP_001681863  140 -------vvdddpqGVARIAAApnhPAVLPLVHNsanaafngpl-----adalladpkARAKLIASLADLavkrgYGGYV 207  Caulobacter s...
YP_001263244  140 -------tsfpdarGKAIISHAhrrPKLMPMIQNalggawdgpg-----iaallrdpkARAATLDRVAALlaanqASGVF 207  Sphingomonas ...
YP_589476     145 vmdasgkvrpvddkLMPYLKAEkaeTEVFPLVNNfdpianewks----digdflddpaSRANFRKQIDAFlgsdrYRGLT 220  Acidobacteria...
YP_001696304   79 kdellltdnavdmlRQTQQQFNeshHVILTLINDyvtdnassvqkdstllhrlvqdssARKKHINNILQVveqyqPDGIE 158  Lysinibacillu...
ZP_02117440   132 -------hiqvddnSVGISRWLkanAPRLQIYPLinsgltthq------tnlvfamnsAREKSIAEIISYlerneLPGIT 198  Methylobacter...
Feature 1          # #                                                      # ##                  
YP_162389     203 FDFESLnkqtlpfYLQLLKETHDRFsah-hwILTVAVPvadeawnlsavanVSDKLILMAYDehypegepGAIASNDWFl 281  Zymomonas mob...
ZP_01058557   246 LDFNTLkvndmqrLAPFWSELTTQFrtnglvSCIVLNPeqtlwq-qpdliqDFDQVILKMFQipwvgsapMPLASDQWFe 324  Roseobacter s...
YP_496869     194 LDFEDLpatamrpYVAFLRETNALLpa--gaQLAVTAPageddwpiaalgrAADKVILMAYDehwqngaaGPIASQTWFt 271  Novosphingobi...
YP_001681863  208 FDLESLsakglvnYPKLLDEARAALkpq-grEVWVTAPfdeegwplkrlqdSSDTLVLMAYDqhyafgdpGPNAGQDWYe 286  Caulobacter s...
YP_001263244  208 FDFEELpadahpaYRAFLTEARRRLpg---mQIAIAVPvadatwdlkayarVADKLFLMAYDehsepgdpGPIASRPWFa 284  Sphingomonas ...
YP_589476     221 LDFEEIpvdsmpgFEALVSEIYQDMhas-gkKLYISVPakntdfnyeavakNSDGLILMNYDehypggpaGAVASQDWFv 299  Acidobacteria...
YP_001696304  159 IDYEKIakedlskYVQFLKELYRELak---kNVTLHVVlepsfp-fdvklpNGPSYTVMAYNvhg--yhsGPGAKATFSf 232  Lysinibacillu...
ZP_02117440   199 LQVPNAtpsneriIINFVRELRRRLgeqqrkLIVMTSLtdgapr--iselsKASDYVLVTTHdntqygrpTPIVPQAWIe 276  Methylobacter...
Feature 1                                                                                         
YP_162389     282 dvveqatqnlppekVIVALGSYAYNWkkgsdtdaisieqawl-------tahesgtvpvfdketGNTHFSYse-aGILHN 353  Zymomonas mob...
ZP_01058557   325 ktlsqavkgieperLVVALGNFAVDWtsgtalpetlsysaavq-----rigeaeaevlfsprtsNSFSRFTds-eGTLHK 398  Roseobacter s...
YP_496869     272 neveksaralpadrLVIALGSYGYDWhqggtdalslsdawl--------aahdshapiifdkasGNAGFAYeq-dGVSHT 342  Novosphingobi...
YP_001681863  287 selakrfakldparTIMALGAYGYDWtlnkngkpasgspatfhea-mrnaqdagatidmdddalNPTYDYVdd-nGDSHV 364  Caulobacter s...
YP_001263244  285 dsvaravrglppdrVVVALGSYAYDWekggdtiahsvedvwl-------aahdsgvvprfdpasGNSSFAYle-gGVRHD 356  Sphingomonas ...
YP_589476     300 enlkfavkhvprekIICAISNYGYEWttignaklpqtahtvstqeawttaeesdadveldgdalNPHITFMeg-eNARHD 378  Acidobacteria...
YP_001696304  233 lndliknikksnqkLAIAFATGGFDWvaqgntvalteleaek-------vlaetnakkqrdkasGAVYFTYtdtsNMSHE 305  Lysinibacillu...
ZP_02117440   277 sqlaalfaradaskIIVSIGSFGIDWdrfgrmkqisvpaawt------lmqnagtplkfdqrslNATLRYRda-nGQPHE 349  Methylobacter...
Feature 1                                   #          
YP_162389     354 VWMLDAVSFYNQTKMSHHLGFNALALWRLGSEDPSLW 390  Zymomonas mobilis subsp. mobilis ZM4
ZP_01058557   399 IWMLDAASAHNQLAVVRQLGLANVAVWSMGQEDPGLW 435  Roseobacter sp. MED193
YP_496869     343 VWMLDAATDWNEMLAVQRLGIGNLALWRLGTEDPGFW 379  Novosphingobium aromaticivorans DSM 12444
YP_001681863  365 VWFLDATTLFNQVKVTDAWKPRGYGLWRMGMEDPGVW 401  Caulobacter sp. K31
YP_001263244  357 IWLLDAAAMHGQIATLRTLGLHQVALWRLGTEDPSVW 393  Sphingomonas wittichii RW1
YP_589476     379 VWFTDGVTALNQMRAAQQLGIDTFALWRLGSEDRSLW 415  Acidobacteria bacterium Ellin345
YP_001696304  306 IWYADQETLEKWVKYVQRKSYHDVVLWRAGGLGVKTL 342  Lysinibacillus sphaericus C3-41
ZP_02117440   350 VWLLDGVTCFNQLRAVLAYKPAGIALFGLGYEDAGIW 386  Methylobacterium nodulans ORS 2060

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap