1JHF,1T7D,1B12,1KN9,1JHC,1JHH,1JHE,1I4V,1AY9,1UMU,2HNF,2HO0,3BDN


Conserved Protein Domain Family
Peptidase_S24_S26

?
cd06462: Peptidase_S24_S26 
Click on image for an interactive view with Cn3D
The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The S26 type I signal peptidase (SPase) family also includes mitochondrial inner membrane protease (IMP)-like members. SPases are essential membrane-bound proteases which function to cleave away the amino-terminal signal peptide from the translocated pre-protein, thus playing a crucial role in the transport of proteins across membranes in all living organisms. All members in this superfamily are unique serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases.
Statistics
?
PSSM-Id: 119396
View PSSM: cd06462
Aligned: 795 rows
Threshold Bit Score: 29.1543
Threshold Setting Gi: 149278479
Created: 8-Jan-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Catalytic site
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:Catalytic site [active site]
Evidence:
  • Comment:These serine proteases carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases.
  • Structure:1T7D: Lipopeptide inhibitor arylomycin A2 blocks the active site of Escherichia coli type I signal peptidase
    View structure with Cn3D
  • Structure:1B12: A beta-lactam inhibitor, (5S,6S)-penem, blocks the active site of Escherichia coli type I signal peptidase
    View structure with Cn3D
  • Citation:PMID 982390

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                #                                                       #               
1JHF_A       111 FLLRVSGMSMkdigimDGDLLAVHktqd----------------vrnGQVVVARIdd---eVTVKRLKkqg--------- 162 Escherichia coli
1T7D_A         9 EPFQIPSGSMmpt-llIGDFILVEkfaygikdpiyqktlietghpkrGDIVVFKYpedpklDYIKRAVglpgdkvtydpv 87  Escherichia coli
YP_966496    152 VCVRVSQDSMapl-lhVGDYVIIDradcvv------------teqghGNIFLVNDpq--dgPTIKRARiqstp------- 209 Desulfovibrio v...
ZP_02982717  198 VVLRVAGDSMepd-yqAGERVLVDtahr---------------tpspPGVYVLWDgf---gLVLKRLEivygse------ 252 Gluconacetobact...
CAM76908     132 RIMHVEGDSMmpt-lhSGDVVLVDlskrl--------------ptppGIFVLFDGm----gLVAKRLEhipnh------- 185 Magnetospirillu...
ZP_00054008  140 RMITITGDSMepl-lsSGDRILIDtsqkv--------------pvppGIFVIWDGm----gLVTKRIEhiphs------- 193 Magnetospirillu...
ZP_02186575  153 KIISIDGDSMepv-lsAGDKVLIDtsrv----------------apsPPGIFVLHdg--lgLVAKQVEyvpnt------- 206 alpha proteobac...
YP_001265299 129 SIIRVAGESMept-lhDGDDILVDrdas---------------eirpGGIYVLRLdd---lLMVKRLLrdd--------- 180 Sphingomonas wi...
ZP_01302473  131 SIIRVDGESMapt-lsDGDDIMVDhddda--------------drlrDGVYVLRLdg---vLMVKRIAmgpl-------- 184 Sphingomonas sp...
YP_457052    121 SIVGVKGDSMept-lsDGDEVLVDasdhg--------------srlrDGIYVLRSdd---aLVVKRIAikpg-------- 174 Erythrobacter l...
Feature 1                                                                                        
1JHF_A           --------------------------------------------------------------------------------     Escherichia coli
1T7D_A        88 skeltiqpgcssgqacenalpvtysnvepsdfvqtfsrrnggeatsgffevpknetkengirlserketlgdvthriltv 167 Escherichia coli
YP_966496        --------------------------------------------------------------------------------     Desulfovibrio v...
ZP_02982717      --------------------------------------------------------------------------------     Gluconacetobact...
CAM76908         --------------------------------------------------------------------------------     Magnetospirillu...
ZP_00054008      --------------------------------------------------------------------------------     Magnetospirillu...
ZP_02186575      --------------------------------------------------------------------------------     alpha proteobac...
YP_001265299     --------------------------------------------------------------------------------     Sphingomonas wi...
ZP_01302473      --------------------------------------------------------------------------------     Sphingomonas sp...
YP_457052        --------------------------------------------------------------------------------     Erythrobacter l...
Feature 1                                                                   
1JHF_A       163 -------------------------nkvELLPEn-sEFKPIVVdlr---qqsFTIEGLA 192 Escherichia coli
1T7D_A       168 piaqdqvgmyyqqpgqqlatwivppgqyFMMGDnrdNSADSRYwgf---vpeANLVGRA 223 Escherichia coli
YP_966496    210 -----------------------tstvlFCYCDn-vRIPPSFIqipqdddnyLSHGVLG 244 Desulfovibrio vulgaris subsp. vulgar...
ZP_02982717  253 -----------------------dpvsvQIMSIn-pGYPTYTRa--------LDEVHIN 279 Gluconacetobacter diazotrophicus PAl 5
CAM76908     186 -----------------------dppkvRVISDn-tFYTPYERt--------ADEVNII 212 Magnetospirillum gryphiswaldense MSR-1
ZP_00054008  194 -----------------------dpptvVIRSIn-pEYQTYERt--------ADEINII 220 Magnetospirillum magnetotacticum MS-1
ZP_02186575  207 -----------------------dpptlVIKSAn-sRYQDYERt--------VDEVTIA 233 alpha proteobacterium BAL199
YP_001265299 181 -------------------------rglVVHSDn-pAHPEIAGf-------dPATLQVI 206 Sphingomonas wittichii RW1
ZP_01302473  185 ------------------------rgrfSVLSDn-aHYPDWTDi-------dPTLVDIV 211 Sphingomonas sp. SKA58
YP_457052    175 ------------------------grqiTIASDn-pAYPTWHDm-------dRSEVHVV 201 Erythrobacter litoralis HTCC2594

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap