Conserved Protein Domain Family
M14_AGTPBP-like

?
cd06235: M14_AGTPBP-like 
Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins
Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the human Nna1/AGTPBP-1 and AGBL -2, -3, -4, and -5, and the mouse Nna1/CCP-1 and CCP -2 through -6. Nna1-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Nna1 is widely expressed in the developing and adult nervous systems, including cerebellar Purkinje and granule neurons, miral cells of the olfactory bulb and retinal photoreceptors. Nna1 is also induced in axotomized motor neurons. Mutations in Nna1 cause Purkinje cell degeneration (pcd). The Nna1 CP domain is required to prevent the retinal photoreceptor loss and cerebellar ataxia phenotypes of pcd mice, and a functional zinc-binding domain is needed for Nna-1 to support neuron survival in these mice. Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain.
Statistics
?
PSSM-Id: 349454
Aligned: 5 rows
Threshold Bit Score: 366.399
Created: 5-Dec-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Zn binding siteactive site
Feature 1: Zn binding site [ion binding site], 3 residue positions
Conserved feature residue pattern:[H] [ED] [H]Click to see conserved feature residue pattern help
Evidence:
  • Comment:Metallocarboxypeptidases share the zinc binding motif HXXE...H, where the zinc ion is penta-coordinated to ND1 atoms of the histidines, OE1 and OE2 atoms of the glutamic acid, and to a water molecule in a slightly distorted tetrahedral manner.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                           #  #       
Q8NDL9     189 IYYHRELLCYSLDGLRVDLLTITschglredreprle------qlfpdtstprpfrfAGKRIFFLSSRVHPGETPSSFVF 262  human
AAG37102   805 IYFRKDVLCETLSGNICPLVTITampesny--------------------yehicqfRTRPYIFLSARVHPGETNASWVM 864  house mouse
Q5VU57     187 DYFFREQLGQSVQQRKLDLLTITspdn--------------------------lregAEQKVVFITGRVHPGETPSSFVC 240  human
Q5U5Z8     418 QFCKLQTLCRSLAGNTVYLLTITnpsqt-------------------------pqeaAAKKAVVLSARVHPGESNGSWVM 472  human
EKG00845   737 IRFEERVLCHTRDGRKLHLLIITsannkkllrrssrhekegsnfsrpsilgpygrfeTGKKVVLLSGRVHPGEVTASHGI 816  Trypanosoma cruzi
Feature 1                                                                                      
Q8NDL9     263 NGFLDFILRpddpraqtLRRlFVFKLIPMLNPDGVVrGHYRTDSrGVNLNRQYlkpdavlHPAIYGAKAVLlyhhvhsrl 342  human
AAG37102   865 KGTLEYLMSnspt-aqsLREsYIFKIVPMLNPDGVInGNHRCSLsGEGLNRQWqspnpelHPTIYHAKGLLqylaav--- 940  house mouse
Q5VU57     241 QGIIDFLVSqhpi-acvLREyLVFKIAPMLNPDGVYlGNYRCSLmGFDLNRHWldpspwvHPTLHGVKQLIvqmynd--- 316  human
Q5U5Z8     473 KGFLDFILSnspd-aqlLRDiFVFKVLPMLNPDGVIvGNYRCSLaGRDLNRHYktilkesFPCIWYTRNMIkrlle---- 547  human
EKG00845   817 HGVISFLLSrdpr-aalVREhFIFYIVPMLNPDGVArGHSRLDQnGFNLNRCYknpdpqiQPTVAALRKVFdylqkt--- 892  Trypanosoma cruzi
Feature 1                                                                                      
Q8NDL9     343 nsqsssehqpssclppdapvsdlekannlqneaqcghsadrhnaeawkqtepaeqklnsvwimpqqsagleesapdtipp 422  human
AAG37102       --------------------------------------------------------------------------------      house mouse
Q5VU57         --------------------------------------------------------------------------------      human
Q5U5Z8         --------------------------------------------------------------------------------      human
EKG00845       --------------------------------------------------------------------------------      Trypanosoma cruzi
Feature 1                 #                                                                    
Q8NDL9     423 kesgvaYYVDLHGHASKRGCFMYGNSfsdest-------------qvenmlYPKLISLNSAHFDFQGcnfseknmyardR 489  human
AAG37102   941 -krlplVYCDYHGHSRKKNVFMYGCSiketvwhthdnsascdivegmgyrtLPKILSHIAPAFCMSSc----------sF 1009 house mouse
Q5VU57     317 pktsleFYIDIHAHSTMMNGFMYGNIfedeer-------------fqrqaiFPKLLCQNAEDFSYSSt----------sF 373  human
Q5U5Z8     548 -erevlLYCDFHGHSRKNNIFLYGCNnnnrky-------------wlhervFPLMLCKNAPDKFSFHsc---------nF 604  human
EKG00845   893 yldrffMYMDFHSHASQSSGFMFGNClpdtvq--------------hwnmvFPKIVSLHAKGVFSYQlcr-------fgR 951  Trypanosoma cruzi
Feature 1                                                                                      
Q8NDL9     490 RDGQSKEGSGRVAIYKASGi-iHSYTLECNYntgrsvnsipaachdngraspppppafpsrytveLFEQVGRAMAIAALD 568  human
AAG37102  1010 VVEKSKESTARVVVWREIGv-qRSYTMESTLcgcdqgry------------------kglqigtrELEEMGAQFCVGLLR 1070 house mouse
Q5VU57     374 NRDAVKAGTGRRFLGGLLDhtsYCYTLEVSFysyiisgtt-----------------aavpyteeAYMKLGRNVARTFLD 436  human
Q5U5Z8     605 KVQKCKEGTGRVVMWRMGIl--NSYTMESTFggstlgnk------------------rdthftieDLKSLGYHVCDTLLD 664  human
EKG00845   952 GHMTSKEGSSRVLFGERLI---HSYTVELTHfsnnrmyid-----------------gacgddenNVNDRNYSIASCYGD 1011 Trypanosoma cruzi

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap