Conserved Protein Domain Family
S2P-M50_PDZ_RseP-like

?
cd06163: S2P-M50_PDZ_RseP-like 
RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP. Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Statistics
?
PSSM-Id: 100084
View PSSM: cd06163
Aligned: 158 rows
Threshold Bit Score: 105.573
Threshold Setting Gi: 114800133
Created: 10-Dec-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active siteputative
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      ##  #                                                             
Q9KPV9         8 FIAFIIALGILVAVHEFGHFWVARRCGVKVEKFSIGFGKSIWkrvghdGTEYSISMIPLGGYVKMLDgrvddvp------ 81  Vibrio cholerae
YP_706520      7 VVLFALGIALSIALHEAGHMWVAQATGMKVRRYFIGFGPKVFsfr-rgETEYGLKALPLGGFCDIAGmtaldele----- 80  Rhodococcus sp....
YP_001536195   7 VTLFALAILISVSLHEAGHLLTAKAFGMKVTRYFVGFGPTLWsfr-rgETEYGIKGIPLGGFCKIVGmtpqdddv----- 80  Salinispora are...
YP_715926     15 IVAFAAALLVSVVLHEGGHFVTARHYGLKASKFFVGFGPTIWsrq-rgETEYGIKAIPAGGFVKIEGmtpleeid----- 88  Frankia alni AC...
O33351         7 IVLFALAILISVALHECGHMWVARRTGMKVRRYFVGFGPTLWstr-rgETEYGVKAVPLGGFCDIAGmtpveeld----- 80  Mycobacterium t...
Q9KYS0         6 IVLFAVGLLFSIAWHELGHLSTAKMFGIRVPQYMVGFGPTLFskk-kgDTEYGVKAIPFGGYIRMIGmfppgpdgrmear 84  Streptomyces co...
NP_601220      8 VVLFFLGIAVTIALHEWGHFITARIFGMKVRRFFIGFGPTVFakr-rgETVYGLKAIPVGGFCDIAGmtaqdeld----- 81  Corynebacterium...
YP_924392     10 VVIFVVAILVSIGLHELGHMIPAKRFGGKVTQYFIGFGPTVWskr-vgETEWGVKAIPLGGYVKIVGmlppgaeeiadev 88  Nocardioides sp...
YP_056214     10 GIVFFGLIILSVLLHECGHFIPAKIFGVKVTEFFAGFGPKIWsft-pgETEYGFKWIPLGGYVRLIGmypakvhhrhsnr 88  Propionibacteri...
NP_789045      6 VLIILIFVYIAVALHELGHMLPAKYFGVPVQKYAIGFGPSLFsfk-krETSYSFNLLPLGGYVQLEGmlppsenprrwfk 84  Tropheryma whip...
Feature 1                                                                                        
Q9KPV9        82 ------------------------------------aeqqamaFDKQSLWKRSAIVSAGPIFNFLFAIFAYWLVfmigvp 125 Vibrio cholerae
YP_706520     81 ------------------------------------pdeedraMYKKPTWKRLAVMSGGIGMNFVLGLVLVYVLavgwgl 124 Rhodococcus sp....
YP_001536195  81 -----------------------------------epadqpraMWRFPVWKRTVVMAAGSIAHFALALIALWIIaitagl 125 Salinispora are...
YP_715926     89 ------------------------------------pedepraFHNARARARLVVMSAGSFVHFVIAIVLIYAVlvtlgt 132 Frankia alni AC...
O33351        81 ------------------------------------pderdraMYKQATWKRVAVLFAGPGMNLAICLVLIYAIalvwgl 124 Mycobacterium t...
Q9KYS0        85 stspwrgm---------------iedarsaafeelqpgdekrlFYTRKPWKRVIVMFAGPFMNLILAVVLFLTVlmgfgi 149 Streptomyces co...
NP_601220     82 ------------------------------------pedlpraMYLKPWWQRIIVLSGGVIMNLIVGFLVLYGVavssgi 125 Corynebacterium...
YP_924392     89 tvdadgnqvvrvrksntgmftqlisdaraaewetirpedserlFYKMPWWKKVVVMAGGPTVNLLIAFTIFWGIfglygv 168 Nocardioides sp...
YP_056214     89 ltrfad-------------------earvaevegitdadqgrlFSDKPVWQRLIIMSGGILTNLLLAFLLFWAVfgihgr 149 Propionibacteri...
NP_789045     85 ------------------------------klmkfaesdspraFWRLPAWKKIIVMFSGPFVNLILATLGYVFVlsvlgl 134 Tropheryma whip...
Feature 1                                                                                        
Q9KPV9       126 avkpvigevtpysiaaqaglepgmeikavsgvntpdwesvnmglighigddsmtitvssaegvglneiktinlrdwnfdp 205 Vibrio cholerae
YP_706520    125 pdlnrstdavvgsvgcaaptqgpgpdyalsectgpgpaeqagirtgdvitavdgkdtptfadvaaatrslsgpvdftier 204 Rhodococcus sp....
YP_001536195 126 pnpnfpstlaqirqepaiiqlatcvvpenevractdadpaspaaqgelrdgdritavngtavtnygdllvalraqqpgqq 205 Salinispora are...
YP_715926    133 kqvseskigstscvattakcsgpgpaaaagmrpddrivsfdgvavhtwkdftrrvrehgagpaslvverdgrqltlapdl 212 Frankia alni AC...
O33351       125 pnlhpptravigetgcvaqevsqgkleqctgpgpaalagirsgdvvvkvgdtpvssfdemaaavrkshgsvpivverdgt 204 Mycobacterium t...
Q9KYS0       150 sqqtttvssvsqcvisqsenpddcaksdpaspaaaaglragdkilafdgvrtddwdklsdliranpgedvpvvverkgee 229 Streptomyces co...
NP_601220    126 pnpdvdttatvdtvqcvpetqisatelsscvgsgpagdagiehgdkilavngqemasftairdailelpgetatltiere 205 Corynebacterium...
YP_924392    169 rtaepdagapvidevsqcvipyaesgrectdsdplspaaeaglrpgdvvttfngtaitgwdqlrsairgnddgkavigye 248 Nocardioides sp...
YP_056214    150 adqtttvaavtpcahsaqtsgpcskedrrapaaeagvragdrivsfngrqvdswsqlqefirgngggevrlgverdgafv 229 Propionibacteri...
NP_789045    135 pvikpviheviantpaasagilpgdeiiaindtaisspgqirgliqdkdlvtlsllkdggtrivslrplngsig------ 208 Tropheryma whip...
Feature 1                                                                                        
Q9KPV9       206 etesamgalgfkpftpeisnqltnvsaqgageraglqvgdtvlqingqaveawqqvvnaiqshpnapiavmveragqqve 285 Vibrio cholerae
YP_706520    205 dgeeqtivvpvqqvq-------------------------------------------------------------rwvq 223 Rhodococcus sp....
YP_001536195 206 aqvaylrddqpgtatvtlg-----------------------------------------------------qtqrppld 232 Salinispora are...
YP_715926    213 vevrrnrvt----------------------------------------------------------------------- 221 Frankia alni AC...
O33351       205 aivtyvdiestqrw---------------------------------------------------------------ipn 221 Mycobacterium t...
Q9KYS0       230 itlhatiatnkvakk-------------------------------------------------------------dsng 248 Streptomyces co...
NP_601220    206 gtlfdvdlqvasv----------------------------------------------------------------trl 221 Corynebacterium...
YP_924392    249 rdgqsmtgttsttvea----------------------------------------------------------rptsat 270 Nocardioides sp...
YP_056214    230 sltpthtlltkvp-----------------------------------------------------------------dl 244 Propionibacteri...
NP_789045        --------------------------------------------------------------------------------     Tropheryma whip...
Feature 1                                                                                        
Q9KPV9       286 ltlipdsrelsqgkvigfagiapkvaewpqnyrfelqfgvfeslgkaveksgqvidltvsmlkkllvgdvglnnlsgpis 365 Vibrio cholerae
YP_706520    224 eegetepheatvgaigvgatpsvvehsalsavpasleftgdmfvmtaerlvqmpskavdlwhavtggerdpetpisvyga 303 Rhodococcus sp....
YP_001536195 233 dpegtvgpvaalgvglipstptrieygpigaiggtadftgtmavntyeamkripqkvpalwtaitggerdvdtpisvvga 312 Salinispora are...
YP_715926    222 --gesgddrvgalgvrpgldtvhynpieavpqtfkvigsgftgmyntlthrigdvgkifsndrdpqgfisvvgaariggd 299 Frankia alni AC...
O33351       222 gqggelqpatvgaigvgaarvgpvrygvfsampatfavtgdltvevgkalaalptkvgalvraigggqrdpqtpisvvga 301 Mycobacterium t...
Q9KYS0       249 qivqgeyvtagflgfssatgvvkqdfgqsvtwmgdrigdavdnlaalpakipalwdaafgdgpreadspmgvvgaarvgg 328 Streptomyces co...
NP_601220    222 asdgseitvgavgmsslpptdvykkygpiegvgatarftgdmisatwdglkafpakipgvvasifgaerdvespmsvvga 301 Corynebacterium...
YP_924392    271 detlhqvgflgvtptthevtttggpiytldqmgemtvvtvkalgtlpvkvwgvakaivgveersidspvsivgggriage 350 Nocardioides sp...
YP_056214    245 stpgrtveagylgvsptmvivhsgpgdtvsqmwtmskqslsalarlpvltwnvasdlvtgqardanspmsivgasrvagd 324 Propionibacteri...
NP_789045    209 ----------------vkfstvnerqsifdalssmvkdtvgvakslialpynlftgladtlhqrkdgvvgligaarisgd 272 Tropheryma whip...
Feature 1                                      #       #                                         
Q9KPV9       366 iakgagttadygfvyfLGFLALISINLGIINLVPLPMLDGGHLLFFMIEAVIRRpvp-----------ekvQEMGYRIGG 434 Vibrio cholerae
YP_706520    304 sviggqiaeqgiweafVLLLASLNFFLGMFNLLPLLPLDGGHMAVTVYERVRDWfrsrrglp-sggpvdymKLLPVTYVV 382 Rhodococcus sp....
YP_001536195 313 sriggeavennawllfFMLFVSLNFFIGVFNLLPLLPLDGGHIAIAWFERARSWvyarlrrp-dpgrvdylKLMPFTYAV 391 Salinispora are...
YP_715926    300 vvsapdssvldrigqfLILVAAINLAVGIFNLLPLLPLDGGHIAVLGFEQARHGlrrlrgyrgpvqkvdfaKLLPATYAT 379 Frankia alni AC...
O33351       302 siiggdtvdhglwvafWFFLAQLNLILAAINLLPLLPFDGGHIAVAVFERIRNMvrsargkv-aaapvnylKLLPATYVV 380 Mycobacterium t...
Q9KYS0       329 eiatldipptqqlamfVMLVAGFNLSLFLFNMLPLLPLDGGHIAGALWESLRRAtakvlrrp-dpgpfdvaKLMPVAYVV 407 Streptomyces co...
NP_601220    302 sriggefversmwdmfMMMLASLNFFLALFNLVPLPPLDGGHIAVVIYEKIRDFfrklrgkp-aggpadytKLMPVTVAV 380 Corynebacterium...
YP_924392    351 tvshqdfpvaekavylLSLIAGFNFFIGMFNFIPLLPLDGGHIAGALWEAVRRGfarlrgrp-dpgyvdvaKLLPIAYGV 429 Nocardioides sp...
YP_056214    325 vagdsqltlgdkiatgASLLGGLNLFLFWFNVVPLPPMDGGHIAGAIYEAGKRGlfklarkp-dpgpadtaMMLPVAWTI 403 Propionibacteri...
NP_789045    273 ivsapsislydklrsmIWIFASLNLALFVFNMIPLLPFDGGYIAAAVFEGARSRvllafrkn-dyapvnisYLLPVTLLV 351 Tropheryma whip...
Feature 1                          
Q9KPV9       435 AIIFSLMAVAIFN-DFTR 451 Vibrio cholerae
YP_706520    383 IIIGGAYMLLTLTaDIVN 400 Rhodococcus sp. RHA1
YP_001536195 392 ILIGGAFTLLTITaDVVN 409 Salinispora arenicola CNS-205
YP_715926    380 VVVLLGFSLLLLSaDIFN 397 Frankia alni ACN14a
O33351       381 LVLVVGYMLLTVTaDLVN 398 Mycobacterium tuberculosis
Q9KYS0       408 AGVFVCFTLLVLVaDVVN 425 Streptomyces coelicolor A3(2)
NP_601220    381 AALLMTVGGLVIVaDVVN 398 Corynebacterium glutamicum ATCC 13032
YP_924392    430 AAVLLVMGVVLIVgDLVV 447 Nocardioides sp. JS614
YP_056214    404 GALMLMMGLVLVVaDVVS 421 Propionibacterium acnes KPA171202
NP_789045    352 TAAIIVMSIMLAWiDIVN 369 Tropheryma whipplei TW08/27

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap