Conserved Protein Domain Family
S2P-M50_PDZ_Arch

?
cd06159: S2P-M50_PDZ_Arch 
Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Statistics
?
PSSM-Id: 100080
View PSSM: cd06159
Aligned: 16 rows
Threshold Bit Score: 158.232
Threshold Setting Gi: 3024951
Created: 9-May-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
active siteputative
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
YP_565005   5 STLFALFLVYWAIVSILdkkgiferynistyGPVLMIRTv-KGQALLDTLArp---kRSWRTFanIGIVLMFVGMLAMFL 80  Methanococcoides b...
Q9HNN6      5 QLLLVGLLAYWAAVSWAqsrgllp-sfvhtsGPITTLHTk-RGKRFLDWMAtp---kRLWRAWgnFGLGLASVVLVGVLI 79  Halobacterium sali...
YP_326785   5 LWVLVGILLYTSVAMALksrgvlp-davsvsGPLLTVHTk-RGRAFLDWLAtp---kRLWRAWgnFGVGIALVIMVGSFL 79  Natronomonas phara...
YP_656881   5 LWVLVGLAAYSAGTFFLsqrgllp-kfvqvqGPFTTIHTq-RGREFIEWIAqp---kRFWRAWtnFGVGTALVIMVGMFA 79  Haloquadratum wals...
NP_378072   5 EVFGISLIVFWGLMYLLrkkleg---kgfqiYPFLLLWRknTRSEWFPKIAr----sNWYKLFekIGVGLGIISLISGIA 77  Sulfolobus tokodai...
P95972     27 YLAVALFLSFWLIIYVFrrrlek---ynltvYPFFILWRk-KSREYWFPKFsr---sKGYRAYekIALPIGFLLMIAGIV 99  Sulfolobus solfata...
YP_023584   4 YLIAALVVFAWIVIIIGlapsirkskyfsllGPALMVKSt-KNFGIIDWISkhfpgkIFSRISvvIVILGAISALGMLLY 82  Picrophilus torrid...
O27421      9 WFYLIAFILIWTMAILFrdrlk-----ieihGPLLMRRTk-RLRGFIDGLAsg--hpKLWRWImnAGIPVAFFFMFYMLY 80  Methanothermobacte...
O57994      8 TYAILGILIFWALISILgtsmrs---esleiAPFQIIWRtkKFINFIDRIGrk--yqRFWKIYgdLGIITGFGGMIFVLY 82  Pyrococcus horikoshii
Q58381      7 KVILIVAIIIWIILYSIrdsin----lktygGIFGILRTk-LGLKTIEKLGk----yKIWQKIgiISIPICVILGFFMLL 77  Methanocaldococcus...
Feature 1                                                               ##  #                 
YP_565005  81 IIIISDIAMLasigestlpepgkfnearnIFLIPGVNefi---plTWGVIALLVTLVVHEFSHAILCRVEGIRVKS-MGI 156 Methanococcoides b...
Q9HNN6     80 ALVLVAITTLlnppept-----sisqpsnVLVIPGVNdflplsvaPEIIAGLFIGIVIHEFGHGLMCRVEGIDVESmGVA 154 Halobacterium sali...
YP_326785  80 AVLASAIGALvepqatg------fvrpqdALVIPGVNqflpwaaaIDIVIGLLVGLVVHEGGHGLLCRVEDIDIESmGVA 153 Natronomonas phara...
YP_656881  80 FLLIQGISILqnppaps-----avnqpenFLVIPGVNdflplsvaPEIIFGLLVGLVVHEGGHGILCRVEGIEIESmGVF 154 Haloquadratum wals...
NP_378072  78 LIFYVISEFIspkapq-------saqlrlEPVIPGVTigi--nqlPYILLAIGISVTLHELAHAVSATSNNVKVRS-GGF 147 Sulfolobus tokodai...
P95972    100 TILYIIIEMLtikpnq-------tptialKPIIPGVTisi--sqlPYILLAIGVSVAIHEIFHALSATSNNVKVKN-GGV 169 Sulfolobus solfata...
YP_023584  83 ESYLAFFIPPsrap-----------alnlYLAIPGINpyi---piGYGIFALVFAVVIHEMFHGIVARRHGIKVNS-VGA 147 Picrophilus torrid...
O27421     81 MLVMSLQNIFvtpqa---------slivpGVDIPGSPvyv---plGYGIIGLATVIVVHEFAHGILARLEGVRIKS-IGL 147 Methanothermobacte...
O57994     83 YFAKQAYNIIrpikpv--------tmpsvQLVIPGVTip-----lVYGLIALAILVIVHELSHGFVARSEDIPLKS-VGL 148 Pyrococcus horikoshii
Q58381     78 NIIDMSIRLLsgtlpk--------eaakpVVFLFGDVip-----wIPGIIALLIAISVHELAHGIFAKSFGIKVKSsGIL 144 Methanocaldococcus...
Feature 1                                                                                     
YP_565005 157 LLAIVPIGGFAEPDEEElfgvkkedteglganttdgpierrilgtekevmpkkvasreqRARILAAGVMSNFVVALIAFI 236 Methanococcoides b...
Q9HNN6    155 LLAVLPVGAFVEPDQDSqada----------------------------------drgsKSRMFAAGVTNNFLVVVVTLA 200 Halobacterium sali...
YP_326785 154 LFAFIPLGAFVQPDEESqdaa----------------------------------drggKTRMFAAGVTNNFLVTAVCFA 199 Natronomonas phara...
YP_656881 155 LLTIIPLGAFVEPDEESerfa----------------------------------srggRTRMFAAGVTNNFAITIIAFV 200 Haloquadratum wals...
NP_378072 148 LFLIFFPGAFVEPDEEEynss----------------------------------nysvRLKILSAGLAVNLILAAIFFP 193 Sulfolobus tokodai...
P95972    170 LLLGIFPGAFVEPDEDDfnks----------------------------------tsnaKLKIIAAGIVINLVLALIALP 215 Sulfolobus solfata...
YP_023584 148 LFFIVPVGAFVEPDEDEvtka----------------------------------dpviRRRIFAAGPGINIVIAVICIV 193 Picrophilus torrid...
O27421    148 LLLAILPGAFVEPDEEDikki----------------------------------rpisKMRIYAAGSVANLILAGICFA 193 Methanothermobacte...
O57994    149 LLFIIIPGAFVEPDEDQlkka----------------------------------plrsRLRVFGAGSFANFVVALISLL 194 Pyrococcus horikoshii
Q58381    145 LLLGLPLGAFVELGDEFktad-----------------------------------kkiRGAIASAGPLANLIIFLTSIP 189 Methanocaldococcus...
Feature 1                                                                                     
YP_565005 237 LFFgpvlgaiapmsdtmiinvtsdssaniaglengmvitqiddtsiqkandiilymnnieagavvqvhaskdhnllvydv 316 Methanococcoides b...
Q9HNN6    201 LLFgpvagavavsdgglvgevhdgtaaaaagfsggdritavggapvanntafrqaldeyddptvpvtlasnetvrverql 280 Halobacterium sali...
YP_326785 200 LAFwmvasfisvapgvavggvlpgsaaddadldrgdvltavngqgvenvsefdaalsdadrevtverkdaapvdvqreli 279 Natronomonas phara...
YP_656881 201 LLFgpiigsitvapglavsgaydespaatagieqgdrittvagtpisneselnnilsersnreitvkindgtsaakresq 280 Haloquadratum wals...
NP_378072 194 LAIylppmlsqglqivgelknypaynssipvnsiilgidghsihtstqletyl--------------------------- 246 Sulfolobus tokodai...
P95972    216 LSFelpylpsalsqgiiiegvlnntpaanaslhtgdiiysingyrlttlsqlh--------------------------- 268 Sulfolobus solfata...
YP_023584 194 LLIfvmmpasapvhngiyiedsavssiptgteiiginnytgsmlcnieytsmirpgtivhaeiyngknvynesiyagvyi 273 Picrophilus torrid...
O27421    194 LFFgissfampaafqpdgvqidsvvpgspaskvltpglviesingmptsnlttysaalktisvg---------------- 257 Methanothermobacte...
O57994    195 LVNgialafephgveiagtikdspaynvlqkgdviigingmkietleefmefmnktrpn--------------------- 253 Pyrococcus horikoshii
Q58381    190 LLSfsytlptelkiidvkepaseflqkgdiiyeingkkinsledfkefak------------------------------ 239 Methanocaldococcus...
Feature 1                                                                                     
YP_565005 317 evgndtddgikgmyvnnvvtdspaeamglesgmliikiddtaisssedfvtfmnftk----------------------- 373 Methanococcoides b...
Q9HNN6    281 svvanasnsplsittndtitavngttvsteselraaladrevaafelndgaatatgpagalvttipdapaatdglsagtn 360 Halobacterium sali...
YP_326785 280 vthavrdgpieqgavvatvdgdavytesalataiegterielglkdesdpvdipvgtfvstvpddeplgaagapdtpmvi 359 Natronomonas phara...
YP_656881 281 tltverelivagsvggnpadinvdaegdpigvetvngtavytqagfsnavgtdrfieltttrgtttipagayltrvasdg 360 Haloquadratum wals...
NP_378072     --------------------------------------------------------------------------------     Sulfolobus tokodai...
P95972        --------------------------------------------------------------------------------     Sulfolobus solfata...
YP_023584 274 enlisgypsekagvkpdsiimsidnktiynvntlgnvldhi--------------------------------------- 314 Picrophilus torrid...
O27421        --------------------------------------------------------------------------------     Methanothermobacte...
O57994        --------------------------------------------------------------------------------     Pyrococcus horikoshii
Q58381        --------------------------------------------------------------------------------     Methanocaldococcus...
Feature 1                                                                                     
YP_565005 374 --------------------------------------tgqvisvetviagkatgdnvsseifeielashpeggsekgfl 415 Methanococcoides b...
Q9HNN6    361 avvvs-----vngtrvptydalsgeldardpgdtisvgayvngsrttteitlgeqsdgssymgiapargvsgvavdgfga 435 Halobacterium sali...
YP_326785 360 h-------------siggeqtpthealsdvlaetepgetvevvafhdedgdpwsgdrhtyevtlsahsdgdhgflgvggi 426 Natronomonas phara...
YP_656881 361 plaqagvpsnpgvivtaidgqrvvssneltavldttqpgeevmveavvsgerkeysvrlgenpqdgsgflgvnifpgtsg 440 Haloquadratum wals...
NP_378072     --------------------------------------------------------------------------------     Sulfolobus tokodai...
P95972        --------------------------------------------------------------------------------     Sulfolobus solfata...
YP_023584 315 -----------------------------------------------------rpgslinmtvfypashitktytmrtvs 341 Picrophilus torrid...
O27421        --------------------------------------------------------------------------------     Methanothermobacte...
O57994        --------------------------------------------------------------------------------     Pyrococcus horikoshii
Q58381        --------------------------------------------------------------------------------     Methanocaldococcus...
Feature 1                                                                                     
YP_565005 416 giyyrpneieieivplgmsigefpakdylaalkaipsmlggftgwiiilglpifgfagegfpgfsgqlaqfyspigwgep 495 Methanococcoides b...
Q9HNN6    436 tlypadtyrgllsgetsgsaylstlfggaddpitgflqavvialylpliglvdptlgfnfagiagmnasfyhvtgvlgvf 515 Halobacterium sali...
YP_326785 427 qagisgfvfddfgidtypaeqyhemlggdglgenpvatfvsqtfgalvlpfmniidptvgynfagfngeitnfydvsgpl 506 Natronomonas phara...
YP_656881 441 llltdfgaqsypagtylellggeggpgaiglsgtiadsplgavyvslvlplasvvlgipnfpgftgavhnfyaitgplep 520 Haloquadratum wals...
NP_378072 247 ------------------------------------------hrggiqtltllfpngsignvsvnisdpqhllgvyltyy 284 Sulfolobus tokodai...
P95972    269 -----------------------------------------ellynystititlkhpngslsnvsvnipnhflgvyvtyy 307 Sulfolobus solfata...
YP_023584 342 tysyyakadpiqnsnayknqsfigveigysglgyepinyihklvfggylfgpgffdeiglpllglspipasmthlfkspf 421 Picrophilus torrid...
O27421    258 -------------------------------evinittdqgtfhlktgrnpnnssraymgirtsnhlrvrdsvasvlgdt 306 Methanothermobacte...
O57994    254 -----------------------------------eeitltvirnkkiinisiilgehperagkgfigiyptqhwiskig 298 Pyrococcus horikoshii
Q58381    240 --------------------------------------------tiepkkeyeikilrdnkiltykivssnegklgimvs 275 Methanocaldococcus...
Feature 1                              #       #                                              
YP_565005 496 lgigifwiantLLWVGWLNFYVGLFNCLPAVPLDGGHVFRDylhalisrfisde--akakevssaiaasFTMLILASFLF 573 Methanococcoides b...
Q9HNN6    516 pdwvtfgaanvLLWTGWVNLNLALFNCIPAFPLDGGHLLRSaaeavtvrlpfe----rpetatraittgIGLLMLCSLLL 591 Halobacterium sali...
YP_326785 507 gagivfalvnvLFWTGWVNINLGIFNCIPSYPLDGGHILRSsteavlarlpge----aspalagavttaVSLVMILSLLG 582 Natronomonas phara...
YP_656881 521 igsgvflianiAFWTAWINLQLGIFNFIPGHPLDGGRILRTsaeavvsrlplpa--sgkrrlvrtittsVGIIMLLSLLL 598 Haloquadratum wals...
NP_378072 285 fppfiyslldfIIWMFTINFSLALFNGAPLIITDGGKVFNEllkkl-------------------gvneKTSYLIQGIIT 345 Sulfolobus tokodai...
P95972    308 ipdyiaailmfFTWLFIVNFSLAVFNAAPLIITDGGKLLTEllkrmlges-----------ngekisyyLQSLFLLIFIF 376 Sulfolobus solfata...
YP_023584 422 dpyiffgianvLYWLFWIDFLLGITNALPLSILDGGQFFKDsltigsrrfrfl----kdeknvnriyygASVLVFLILIW 497 Picrophilus torrid...
O27421    307 lpfaltyleelFFWIFFLNFAVGTVNLLPAKPLDGGLMFEEllryrlper-----------ivkpavsyVSIFVILIIAV 375 Methanothermobacte...
O57994    299 fdkpltivlttFYWIYVLNFGVGLMNLLPVIPLDGGRMLIDtltelspk-------------fgkaigySIMLISLLLLG 365 Pyrococcus horikoshii
Q58381    276 ptkntalfintIYWTYWFNFLLALFNLLPAMPLDGFHVWNAfpellkerknrfiskvgqilelfinektLGSITLLVWWV 355 Methanocaldococcus...
Feature 1          
YP_565005 574 MIFGP 578 Methanococcoides burtonii DSM 6242
Q9HNN6    592 MLFGP 596 Halobacterium salinarum
YP_326785 583 LLFIP 587 Natronomonas pharaonis DSM 2160
YP_656881 599 LVFGP 603 Haloquadratum walsbyi DSM 16790
NP_378072 346 MLFIS 350 Sulfolobus tokodaii str. 7
P95972    377 AIFLS 381 Sulfolobus solfataricus
YP_023584 498 VIIAP 502 Picrophilus torridus DSM 9790
O27421    376 SIIWG 380 Methanothermobacter thermautotrophicus str. Delta H
O57994    366 INLIP 370 Pyrococcus horikoshii
Q58381    356 ILGSI 360 Methanocaldococcus jannaschii

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap