1WLJ


Conserved Protein Domain Family
ISG20

?
cd06149: ISG20 
Click on image for an interactive view with Cn3D
DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins
Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20) is an IFN-induced antiviral exonuclease with a strong preference for single-stranded RNA and minor activity towards single-stranded DNA. It was also independently identified by its response to estrogen and was called HEM45 (human estrogen regulated transcript). ISG20 is a DEDDh-type DnaQ-like 3'-5' exonuclease containing three conserved sequence motifs termed ExoI, ExoII and ExoIII with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. ISG20 may be a major effector of innate immunity against pathogens including viruses, bacteria, and parasites. It is located in promyelocytic leukemia (PML) nuclear bodies, sites for oncogenic DNA viral transcription and replication. It may carry out its function by degrading viral RNAs as part of the IFN-regulated antiviral response.
Statistics
?
PSSM-Id: 99852
View PSSM: cd06149
Aligned: 7 rows
Threshold Bit Score: 276.626
Threshold Setting Gi: 58177183
Created: 28-Feb-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #### #                                     #   #                             
1WLJ_A         8 VAMDCEMVGLGPH-RESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGKLV 86  human
Q9H9L3       180 VAIDCEMVGTGPKgHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIV 259 human
AAI22471     196 VAIDCEMVGTGPNgRNSDLARCSIVNWFGDVMYDKYIKPKSPVTDYRTRWSGIRREHLVNATPFDVAQKEILKILSGKVV 275 African clawed ...
NP_001096663 137 LALDCEMVGTGPKgAQSELARCSIVSYDGDVVYDKYVKPINPVTDYRTRWSGIRRQDLLHATPFYHAQKEIVKIITGKVV 216 zebrafish
XP_001232173 118 VAIDCEMVGTGPGgCTSSLARCSIVGYEGDVLYDSYVRPTEPIVDYRTRWSGIRKKHMVNAVPFCKAQREILKILSGKVV 197 chicken
CAG01049       5 VALDCEMVGTGPGgRCSELARCSIVGYHGTVLYDKYVQPCQPVTDYRTPWSGIQRHHLQNATPFAQAREEILAALDGKVV 84  spotted green p...
XP_687566    136 VAMDCEMVGTGPGgRRSEVARCSIVDYYGNVVYDSYILPQDPVTDYRTRWSGIRSHHLRQAVPFEHAQNEILKILKGKII 215 zebrafish
Feature 1          ## ###                                                      #    #         
1WLJ_A        87 VGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLdhcrRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQ 163 human
Q9H9L3       260 VGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCpenaTMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYK 336 human
AAI22471     276 IGHAIHNDYKALNYFHPKEMTRDTSKIPLLNRRAGFpekeVASLKRLAKQLLHKDIQTGRQGHSSVEDAKTTMELYR 352 African clawed frog
NP_001096663 217 VGHAIHNDFKALKYFHPAFQTRDTSRIPLLNEKAGFpekqCVSLKKLTQAILKRDIQTGYRGHSSVEDAKATMELYK 293 zebrafish
XP_001232173 198 VGHAVHNDFKALKYSHPKELTRDTSKIPLLNQKGGFpenvAISLKRLAKELLHKDIQVGKSGHCSVEDARTTMELYK 274 chicken
CAG01049      85 IGHSVHNDFKVLDIAHPGHMVRDTSTSPLLSRLAGLs--cRRSLKVLSRRLLKRRIQGGRRGHNSVEDAQAALDLYK 159 spotted green puff...
XP_687566    216 VGHALYHDLNVLYISVQPHMIRDTCSCVLLRQLYDAnqncNISLKKLAQKLLNRTIQVDRQGHCSVEDALSALDLYK 292 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap