
Conserved Protein Domain Family

cd06134: RNaseT 
Click on image for an interactive view with Cn3D
DEDDh 3'-5' exonuclease domain of RNase T
RNase T is a DEDDh-type DnaQ-like 3'-5' exoribonuclease E implicated in the 3' maturation of small stable RNAs and 23srRNA, and in the end turnover of tRNA. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. RNase T is related to the proofreading domain of DNA polymerase III. Despite its important role, RNase T is mainly found only in gammaproteobacteria. It is speculated that it might have originated from DNA polymerase III at the time the gamma division of proteobacteria diverged from other bacteria. RNase T is a homodimer with the catalytic residues of one monomer contacting a large basic patch on the other monomer to form a functional active site.
PSSM-Id: 99837
Aligned: 16 rows
Threshold Bit Score: 340.039
Threshold Setting Gi: 29654993
Created: 28-Feb-2008
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:putative active site [active site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #### #                                                                
Feature 1                                    ## ###                                              
Feature 1                 #    #               
2F96_A       184 GXEFDNREAHSARYDTEKTAELFCGIVNRW 213 Pseudomonas aeruginosa
Q8PAG3       180 GLDWNSADAHSAVYDTEQTARLFCKIANAW 209 Xanthomonas campestris pv. campestris
YP_001209227 167 GFEYDSERAHGAKYDTELTAQIFCHIINTW 196 Dichelobacter nodosus VCS1703A
ZP_01450509  169 NIAFDQKQAHGALYDAQRTAELFCFMMNRY 198 alpha proteobacterium HTCC2255
YP_114507    170 GLSWDHQEAHSAAYDANQTARLFCTIVNRW 199 Methylococcus capsulatus str. Bath
NP_820685    173 NLPFDKKEAHSAIYDAKCAAELFCKITNQI 202 Coxiella burnetii RSA 493
YP_390867    169 EIEWDNSKAHSAEYDTIKTADLFCKIVNQW 198 Thiomicrospira crunogena XCL-2
YP_096957    173 GLHFDSQEAHSAIYDAEKTADLFCLMINKW 202 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
ZP_01217165  167 NIDYNNEEAHSALYDTQVTADLFFYMVNKL 196 Psychromonas sp. CNPT3

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap