Conserved Protein Domain Family
CaCS_like

?
cd06116: CaCS_like 
Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group is similar to gram-negative Escherichia coli (Ec) CS (type II, gltA) and Arabidopsis thaliana (Ath) peroxisomal (Per) CS. However EcCS and AthPerCS are not found in this group. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). Some type II CSs are strongly and specifically inhibited by NADH through an allosteric mechanism. C. aurantiacus is a gram-negative thermophilic green gliding bacterium, its CS belonging to this group may be a type I CS; it is not inhibited by NADH or 2-oxoglutarate and is inhibited by ATP. Both gram-positive and gram-negative bacteria are found in this group.
Statistics
?
PSSM-Id: 99869
View PSSM: cd06116
Aligned: 4 rows
Threshold Bit Score: 736.638
Threshold Setting Gi: 163849332
Created: 28-Mar-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 #                                                                      
YP_001637376  44 GLMSYDPAYLNTASCKSSITYIDGDKGILEYRGYPIEQLAEQSSYLEVAYLLLYGELPSKERLAWWEYRISRHLFLHNSL 123 Chloroflexus au...
NP_662713     46 GLLGYDPAFLNTCSCKSTITFIDGDKGILRYRGYPIEQLAEKSSFLETAYLLIKGELPDKERLAVWTYNIRHHTMTHANL 125 Chlorobium tepi...
YP_822928     42 GLMTYDPAFMNTASCQSAITYLDGEKGILRYRGYPIEQLAEQCSFLEVAYLLLNGELPTAEQLEYWQCKVMRHTMTHENV 121 Solibacter usit...
YP_644449     58 GLMTYDPGYTNTASCRSAITYIDGERGILQHRGIPIEELCEHSTYLEVAYLLIHGHLPTEEELSQWVYDITHHTYVHENI 137 Rubrobacter xyl...
Feature 1                                                                                        
YP_001637376 124 VELIQAFRYDAHPMGILISSVAAMSTLYPeAKNIHDpaVREKQIWRIIGQIPTIAAFAYRHRIGRPFNLPDSSLSYTANL 203 Chloroflexus au...
NP_662713    126 TKFMDGFRYDAHPMGILVGTLGALSTFYPdAKNVGEeeSRKLQVRRLIGKMPTLAAMSFRHSLGFPYVLPDNDLSYAGNF 205 Chlorobium tepi...
YP_822928    122 KKFMDGFHYDAHPMGILISTVAALSTFYPeAKNVGDakCRHKQIVRLIGKMPTLAAYAYRHRLGLPYIAPDPELGYTKNY 201 Solibacter usit...
YP_644449    138 KSFMDGFRHDAHPMGILLASVGALSTFYPeASDIDDeeQRNMAAIRLIAKMPTIAAFAYRHSLGLPYVYPDNDLSYTGNF 217 Rubrobacter xyl...
Feature 1                                       #  #                              ### #  #       
YP_001637376 204 LYMMDymnqreYEVNPVLAKALDVLFILHADHEQNCSTSVMRSVGSSHADPYNALAAAAAALYGPLHGGANEAVLRMLQQ 283 Chloroflexus au...
NP_662713    206 LSMMFrmteknYKPNPVLEHALDVLFILHADHEQNCSTNAVRSVSSSMVDPYSAIAAGCAALYGPLHGGANEAVIHMLKQ 285 Chlorobium tepi...
YP_822928    202 MNMLWkrtepkYAANPVLARALEVLFILHADHEQNCSTSTMRAVGSSNADPFVTTSAAIAALSGPLHGGANEEVLRMLDE 281 Solibacter usit...
YP_644449    218 LSMLFkmaepkYEPDPRLEKALDVLFILHADHEQNASTSAVRTVGSTRADPYTAVAAGVAALYGPLHGGANVAVLKMLQR 297 Rubrobacter xyl...
Feature 1                           ########  #    #                                        # #  
YP_001637376 284 IGHPKNVPAFIERVKKGEMRLMGFGHRVYKNYDPRAKIIRKIAHEVFAATAa-nPLLDVAMELERTALEDEYFISRKLYP 362 Chloroflexus au...
NP_662713    286 IGSVDKIPEFIKLVKSGEGRLMGFGHRVYKNYDPRARIIKKIAFDVFEETGr-nPLLDIAIELERIALEDDYFIQRKLYP 364 Chlorobium tepi...
YP_822928    282 IGKPENIPGFIEQVKEGKRKLMGFGHRVYKNYDPRARIIKQVAEEVFEVTGr-nPKIDIALELEKIALSDDYFIKRKLYP 360 Solibacter usit...
YP_644449    298 IGSVKNIPDFLETVKQGKERLMGFGHRVYKNYDPRARIIKSHVDEVLEATGkesPWLDIAVELEKRALDDEYFTSRKLYP 377 Rubrobacter xyl...
Feature 1        # #                    #   #                 #  #                
YP_001637376 363 NVDFYSGLIYQALRFPieYFPFLFAIPRASGWLAQWIEMLEDPeQKITRPRQVYVGpqrrdYVPI 427 Chloroflexus aurantiacus J-10-fl
NP_662713    365 NVDFYSGLIYQAMGFPteMFPVLFAIGRTPGWLAQWIEHVKDPeQKIARPRQIYLGekcrdYVPI 429 Chlorobium tepidum TLS
YP_822928    361 NVDFYSGIIYQAMGFTpdQFTVLFGIPRTVGWLAQWQEMQQDPdKKIARPRQVYTGederdFVPI 425 Solibacter usitatus Ellin6076
YP_644449    378 NVDFYSGLIYEALGIPteAFTVMFAIPRTSGWIAQWMEMLRDPeLKIARPRQIYTGprdqhYVPM 442 Rubrobacter xylanophilus DSM 9941

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap