Conserved Protein Domain Family
citrate_synt_like_1_1

?
cd06112: citrate_synt_like_1_1 
Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs. Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site. Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers). Some type II CSs are strongly and specifically inhibited by NADH through an allosteric mechanism.
Statistics
?
PSSM-Id: 99865
View PSSM: cd06112
Aligned: 8 rows
Threshold Bit Score: 689.16
Threshold Setting Gi: 177660411
Created: 5-Nov-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #                                                                          
YP_390620     3 YIPGLAGVPATESEISYIDGnkgVLTYRGYDIMELAEYSsFEETTLLLLFGNLPTADELADFENKLRNARRVKYNLREIM 82  Thiomicrospira c...
YP_904238     4 YIPGLAGVPATESSISYIDGkngILTYRGYSIEDLVKYGsFEEVSMLLRDGELPDKNKLDNFKNILHKRYEVKRNIRSMM 83  Candidatus Ruthi...
ZP_01453486  15 YSPGLAGIPAAESSISYVDGqhgYLEYRGIDIEQLAEHSsFEETAWLLLYGTLPTADELAAFDKELRHHRRVKFRIRDMM 94  Mariprofundus fe...
Q59977       11 FKEGLAGVPAAKSRVSHVDGtdgILEYRGIRIEELAKSSsFIEVAYLLIWGKLPTQAEIEEFEYEIRTHRRIKYHIRDMM 90  Synechocystis sp...
P51045        6 FAPGLEGVAATQSSISNIDGaagLLSYRGFAIADLAAHSsFEEVALLLLDGVLPGAADLERFDHGLRAHRQVKYNVREIM 85  Acidithiobacillu...
YP_344611     4 YLPGLEGVPATQSNISDVDGergILSYRGYPIEDLAERStFEETTLLLLDGELPTAQRLEEFTQELRQNYRVKYNIRTLM 83  Nitrosococcus oc...
ZP_02732426   7 YKPGLEDVPAAKSAVSFLDGkkaVLEYRGIPVEVLAKESsFEEVSWLLVKGDLPTQKQLAEFDHDLRQRRAIHFRLKDLI 86  Gemmata obscurig...
ZP_02938914   3 IIPGLADVPVAYTKICLLDGkngKLIYRGYDVEELFEKSkYLETVYLLIFGDLPSKAEYENFKKDIKLHSRLKFRIIDVM 82  Sulfurihydrogeni...
Feature 1                                                                                       
YP_390620    83 KNLPATTHPMHMLQVAVASLASFYpsteymkg--gtenqeyiNEVTVNIISHMGTLVAMWEHMRNGFDPIEPRKDLTYAE 160 Thiomicrospira c...
YP_904238    84 WSLPANGHPMNVLQTTIAAMATFYpdagaqn-----pdsvytQGALTKIISNMSTLVAMWARISAGYDPIPPSRGMSYAK 158 Candidatus Ruthi...
ZP_01453486  95 KCFPESAHPMDSLQATVAALGMYYpfpksekg---rldpktaHQVCVNLIAKMPTLVAAHARMRHGDDPIAPRDDLSHAA 171 Mariprofundus fe...
Q59977       91 KCFPETGHPMDALQTSAAALGLFYarrald-------dpkyiRAAVVRLLAKIPTMVAAFHMIREGNDPIQPNDKLDYAS 163 Synechocystis sp...
P51045       86 KFMPVTGHPMDMLHCAVASLGMFYpqqelsda--ergntlhlDAMAMRIIARMPTIVAMWEQMRFGNDPISPRPDLSHAA 163 Acidithiobacillu...
YP_344611    84 TALPSTGSPMEMLQAGVSALGMFYpgnecltdsdsctdrdyvDNMTVKIIARMPALVAMWEHIRNGYDPIPPRPDLPIAD 163 Nitrosococcus oc...
ZP_02732426  87 KCMPADGHPMDALHAGVAALGMFYpcptvs-------npaknWDATCRLIAALPTLVAAFARVRRGEEILDPRSDLDHAG 159 Gemmata obscurig...
ZP_02938914  83 KNFPEKAHPIEVLQSVVSCLGMFYkkenvl-------nedyqYLSIVKLLAKIPLIIANWNRIRNGDNPLEPNPDFDYVE 155 Sulfurihydrogeni...
Feature 1                                   #  #                              ### #  #          
YP_390620   161 NFLYMvtGEEPdkDWARLLDACLILHAEHTINASTFTTMVTGSTLANPCSVISSAIASLSGPLHGGANQKVIEMLDEIGt 240 Thiomicrospira c...
YP_904238   159 NFLYMsfGEEPddDIVKLFDACLILHAEHTINASTFSAMVTASTLANPFASISAAVGTLAGSLHGGANEDVLKMLDEIGd 238 Candidatus Ruthi...
ZP_01453486 172 NFFYMltGEEPypLTERIMDVALIVHAEHTMNASTFSTLVVASTHADPYSSISAAIGALAGPLHGGANEDVLHMLDEIGs 251 Mariprofundus fe...
Q59977      164 NFLYMltEKEPdpFAAKVFDVCLTLHAEHTMNASTFSARVTASTLTDPYAVVASAVGTLAGPLHGGANEEVLNMLEEIGs 243 Synechocystis sp...
P51045      164 NFLYMlsGREPdpAHTKILDSCLILHAEHTINASTFSVLVTGSTLTNPYHVIGGAIGTLAGPLHGGANQKVVEMLEEISs 243 Acidithiobacillu...
YP_344611   164 NLLYMfyGEEPdpLLAKIMDTCLILHAEHTTNASTFATLVTASTLASPYAVISGAVGTLSGPLHGGANERVVEMLREIGr 243 Nitrosococcus oc...
ZP_02732426 160 NFYYMlfGKEPspATRKVLDACLILHAEHQMNASTFTARVTGSTLATPYHTIASAIGSLSGPLHGGANEEALRQFEEIGg 239 Gemmata obscurig...
ZP_02938914 156 NFLYMyfGQKPtkEKVEILEKCLILHAEHSMNASTFAAIVVGSTLADPFTVISSAIGALSGPLHGGANEDVIKMFKEIEs 235 Sulfurihydrogeni...
Feature 1                         ########  #    #                                         # #  
YP_390620   241 penARPYIEKRLAE--KKVIWGMGHREYKTKDPRATILQKLSSELlqnksdagslskaFETAMEVERVCEELLGHKGVYP 318 Thiomicrospira c...
YP_904238   239 aknARAYIKNRLKN--KQIIWGMGHREYSVKDPRASILQSMIEDYvkksnm--hfskrFETALEVERICEDLLSSKGVYP 314 Candidatus Ruthi...
ZP_01453486 252 veaADAYLNNKLSK--KEKISGLGHRVYKTKDPRATLLQKLYVELtekmg----sdptYEIARHIEELSKSTLGSKGVCP 325 Mariprofundus fe...
Q59977      244 venVRPYVEKCLAN--KQRIMGFGHRVYKVKDPRAIILQDLAEQLfakmg----hdeyYEIAVELEKVVEEYVGQKGIYP 317 Synechocystis sp...
P51045      244 vqqVGAYLDRKMAN--KEKIWGFGHRIYKTRDPRAVILKGMMEDMashgnl--rhsslFEIAIEVERQATERLGAQGIHA 319 Acidithiobacillu...
YP_344611   244 penVKTWLDKQLDR--KQIIWGFGHRVYKVKDPRAKILQKLMERLpaergg--qlsplFETAIALEEAATERLGHKGIYA 319 Nitrosococcus oc...
ZP_02732426 240 peqVKGWLDAKRAVdsKYKVMGMGHRVYKVKDARATVLQEIAEHMfaeta----rpktYETALELERLCAGIYGPKGIYP 315 Gemmata obscurig...
ZP_02938914 236 lqnVKKYIDEKLES--KKKIPGFGHRIYKTYDPRAKLLKKILENLeikde---elrnlYSIAQEVEKYVLEKLSHKGVYP 310 Sulfurihydrogeni...
Feature 1       # #                     #   #               #  #                
YP_390620   319 NVDFYSGILYKEMGFD-AGLFTPIFAVARSAGWMAHWREQLQNNKIFRPTQIYTGAGNSCYLPM 381 Thiomicrospira crunogena XCL-2
YP_904238   315 NVDFYSGILYAEIFKIpQTHFTPIFAMARSAGWTAHWHEQVGHNRIFRPAQIYIGSNFRNYSKK 378 Candidatus Ruthia magnifica str....
ZP_01453486 326 NVDFYSGIVYRKLGIA-TDLFTPIFAVSRVAGWLAHWKEQLGDGRLYRPNQIYRGLRDQTYVPI 388 Mariprofundus ferrooxydans PV-1
Q59977      318 NVDFYSGLVYRKLDIP-ADLFTPLFAIARVAGWLAHWKEQLSVNKIYRPTQIYIGDHNLSYVPM 380 Synechocystis sp. PCC 6803
P51045      320 NVDFYSGVLYHEMGIK-ADLFTPIFAMARSAGWLAHWREQLADNRIFRPTQVYTGEQDRRYVPV 382 Acidithiobacillus ferrooxidans
YP_344611   320 NVDFYSGILYMELGIP-IDQFTPLFAVSRSAGWLAHWHEQLSDNRIFRPTQVYVGEPLRRYVPL 382 Nitrosococcus oceani ATCC 19707
ZP_02732426 316 NVDFYSGVVYQSLGIP-TDVFTPIFAIARVSGWLAHWTEQLVGNRIFRPEQISIGKTDVKYVPL 378 Gemmata obscuriglobus UQM 2246
ZP_02938914 311 NVDFYSGLVYKYLGFG-EDMYTSLFALARVSGWLAHWKEYITDNKLIRPTEIYIGEIDKKYNDR 373 Sulfurihydrogenibium sp. YO3AOP1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap