2C6X


Conserved Protein Domain Family
BsCS-I_like

?
cd06109: BsCS-I_like 
Click on image for an interactive view with Cn3D
Bacillus subtilis (Bs) citrate synthase CS-I_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains proteins similar to BsCS-I, one of two CS isozymes in the gram-positive B. subtilis. The majority of CS activity in B. subtilis is provided by the other isozyme, BsCS-II (not included in this group). BsCS-I has a lower catalytic activity than BsCS-II, and has a Glu in place of a key catalytic Asp residue. This change is conserved in other members of this group. For E. coli CS (not included in this group), site directed mutagenesis of the key Asp residue to a Glu converts the enzyme into citryl-CoA lyase which cleaves citryl-CoA to AcCoA and OAA. A null mutation in the gene encoding BsCS-I (citA) had little effect on B. subtilis CS activity or on sporulation. However, disruption of the citA gene in a strain null for the gene encoding BsCS-II resulted in a sporulation deficiency, a characteristic of strains defective in the Krebs cycle. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. Many of the gram-negative species represented in this group have a second CS isozyme which is in another group.
Statistics
?
PSSM-Id: 99862
View PSSM: cd06109
Aligned: 16 rows
Threshold Bit Score: 440.589
Threshold Setting Gi: 8894738
Created: 18-Oct-2007
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 26 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #                                                                            
2C6X_A          3 YGLKGITCVETSISHIDGekGRLIYRGHHAKDIALNHsFEEAAYLILFGKLP--STEELQVFKDKLAAE-RNLPEHIERL 79  Bacillus subtilis
NP_629955      17 RGLAGVVVADTEVGDVRGleGFYHYRQYSAVELARSRgFEDVWHLLVHGELP--DARTGAAFAAETAAL-RRLPDAVRAA 93  Streptomyces c...
jgi:Rxyl_2557  25 PGLEGVVATRTRLSMVDGaaGRLVIAGFPVEELAGRAsFEETLYLLWNGVLP--DAGRLEGLRGDLAAR-RALPEAAGEV 101 Rubrobacter xy...
ZP_01172554    14 KGLKGILAAETSVGHVDGlkGQLIYRGYEIGELTRKCsFEEAAFLLWHGRLP--ARGELDDLKTELHSF-RAIPPHVASI 90  Bacillus sp. N...
YP_177535       5 KGLENVVVAETTISAIDGeqGTLLYRGYQAEELAKSAdFEDVAYLLLNGQRP--TEAEKDDFSTALKTM-RPLPDDLKKL 81  Bacillus claus...
YP_001412137   18 SGLDNVVAAETMLSHVDGeaGRLIVAGYEVEDLVKAHdFEGAAAALWNAAGLe-NAPSEEAVRRDLGRArEAAFALVPGL 96  Parvibaculum l...
NP_766823      10 IGLDGVPAAETVLSHVDGerGELIIAGEHVGRLAAKSsFEGVTARLWNGASK--TSLSEANVRASLGAArERAFARLAEL 87  Bradyrhizobium...
YP_001546906    9 VGLEGIVAAATRLSSVDGqaGELIIAGFPLERLAPFAtFEETIFLLWNDHLP--SQSELAELRQSLASQ-RQLPALTLEV 85  Herpetosiphon ...
ZP_01548912    34 AGLEGVVAATTMLSHVDGqeGVLVLYGRHIEDLAGKLsFEDAVRHLWQDFDLpeASGLREAFGKARRAA-FAVMPVLEAA 112 Stappia aggreg...
YP_762125       3 SGLENIVAAETVLSDVDGqnGRLVIRGWPVELLSASMaFEDTAHLLWEGFFE--DLRDVSSLGRQLGEArEAAFAIVSGI 80  Hyphomonas nep...
Feature 1                                                                                         
2C6X_A         80 Iqsl---pnnMDDMSVLRTVVSALgenty-------tfhpkTEEAIRLIAITPSIIAYRKRWTRGEQAIAPSSQyGHVEN 149 Bacillus subtilis
NP_629955      94 LpaiaeagagSGPLAGMRTGLSLLgaalgfrpvydlsvdqrRQDTLVAAAAVPTLLTALHRLGRGLEPVEPREDlSYAAN 173 Streptomyces c...
jgi:Rxyl_2557 102 Leaav--aggAAPIDALRMAAGTLaps-----------gndRDDALTSVAAFPTIVAACWRLSQGREPVEPDPGlSHAAN 168 Rubrobacter xy...
ZP_01172554    91 Itam---pvsFSMMDVLRTAVSSLggsl---------ekpaVRQAVQLTALIPVMIAFRSRLLEGKQPVDPEPSlGHAAN 158 Bacillus sp. N...
YP_177535      82 Laal---pkdLSMMDALRTLISSYtgkeg--------wppqQQEAMRLVAIVPTIVAAWANRSCGKDAIEPDPSlNHVAN 150 Bacillus claus...
YP_001412137   97 Lsln----chETVTEGLRTGLSMLsdepae------gpakdIPAHIRALGAAAVFTAALCRAREKKSPVAPDARsGHAED 166 Parvibaculum l...
NP_766823      88 Lpat----hgMGIVDGFRAAVAGLrae------------hgLEHEATIVGAFPVISGALVRRAKGLDPVAPDPSaSHAAD 151 Bradyrhizobium...
YP_001546906   86 Aqqlg--reqADPMDALRAATATLnpl-----------adeKATAQRIVAALPTIVAAYWRARNQAEFIEPRSDlSHAAN 152 Herpetosiphon ...
ZP_01548912   113 Ps-------sLSVYERMQLGLAALpls------------tgLPDAIAISGALPVFLAASHRIATGQSPIAPDSTlETATD 173 Stappia aggreg...
YP_762125      81 Pd-------gLDSVSFLRAGWALLpdd------------esLETAIRLAGSAPVLTAAAIRRGRGEPPIAPNAQlSQSAD 141 Hyphomonas nep...
Feature 1                                    #  #                              ### #  #           
2C6X_A        150 YYYMLtGEQPseAKKKALETYMILATEHGMNASTFSARVTLSTESDLVSAVTAALGTMKGPLHGGAPSAVTKMLEDIgek 229 Bacillus subtilis
NP_629955     174 YLYMLtGQEPdeACTRAIEQYLISTIDHGFNASTFTARVIASTGADVAACLAGAVSALSGPLHGGAPSRALDTLDAIgtp 253 Streptomyces c...
jgi:Rxyl_2557 169 YLYMLsGEVPgeERVRALETYLNTVSDHGMNASTFAARVISSTGSDLISAVVGAIGALKGPLHGGAPGPALDVVFEIgep 248 Rubrobacter xy...
ZP_01172554   159 YLYMLkGQIPekAHSEALETYLLLTMEHGMNASTFSARVTASTESDLISAITSAIGTMKGPLHGGAPSGVIELLDEImer 238 Bacillus sp. N...
YP_177535     151 YLYMLtGEKPhaAHIRALSAYLILTAEHGMNASTFAARVIASTEADLRSAICGALGALKGRLHGGAPTGVLELFSDIqta 230 Bacillus claus...
YP_001412137  167 FLRMLrGEAAsaAEVEALNAYLVTVADHGMNASTFTARVIASTRAGTISAVVGALCALKGPLHGGAPGPVLDMLDDIgtr 246 Parvibaculum l...
NP_766823     152 TLRMLhGRAPatREVTALDAYLVTVCDHGMNASTFTTRVVASTQADLFAAVTAGYCALTGPLHGGAPEPVLEMLDAIgsr 231 Bradyrhizobium...
YP_001546906  153 YLWMLtGKEPsaEKVRALETYLNTVVDHGLNASTFTTRVIISTESDLVSAITGAIGALKGPLHGGAPGPALDMVFEIgta 232 Herpetosiphon ...
ZP_01548912   174 LLRMLsGELPpaAHAAALNRYLVTILDHGLNASTFTARVIGSTQANLKQAVLGAMGALSGPLHGGAPGPVLDMIDAIgrp 253 Stappia aggreg...
YP_762125     142 FLHMLtGKVPhqAEARALDAYLVTVCDHGLNASTFAARVVASTRAGLTSAAIAGISALKGPLHGGAPGPVLDMLDAIgvp 221 Hyphomonas nep...
Feature 1                         ########  #    #                                         # #  # 
2C6X_A        230 -ehaEAYLKEKLEKGERLMGFGHRVYKTKDPRAEALRQKAEEVagnd---rdldLALHVEAEAIRLLEIYKPgRKLYTNV 305 Bacillus subtilis
NP_629955     254 -driDAWIRERVLAGDRIMGFGHAVYRTEDPRSRMLREVAQSFggp-----rveFAVEVERQVEAILAELKPgRELHTNV 327 Streptomyces c...
jgi:Rxyl_2557 249 -graEGVLRERLDRGERLMGFGHRVYKVRDPRADVLAGAAERLyasdadeelyrLALEVERTALRLLEEYKPgRNLDTNV 327 Rubrobacter xy...
ZP_01172554   239 -gdaEAVIREKLERGEKLMGFGHRIYKTLDPRAAALKDKLQQFaghd---twldMALVTEQTALRLLGEYKPgRSLYTNV 314 Bacillus sp. N...
YP_177535     231 dtssETLLREKLERGERLMGFGHRVYKTTDPRANALREVLKSLnnqe---tflsEAVAIEQLATQLLAEYKPgRQLHANV 307 Bacillus claus...
YP_001412137  247 -eniEPWLAREIAKGERLMGFGHRVYRVRDPRADVFNKAVTILtngn---ervlFARDVEVAALAALRKAKPgNRIDTNM 322 Parvibaculum l...
NP_766823     232 -eriQPWVDAALARGERMMGFGHRVYRVRDPRADVLKTAIEALasng---adlpFAGEVEAYIRAALRKKNPdRPLETNV 307 Bradyrhizobium...
YP_001546906  233 -draEEVLRAKLARGERLMGFGHRVYKVRDPRAEVLAGAADQLfandgnrelyeLVRHVEQTAIRLLEEHKPgRKLQTNV 311 Herpetosiphon ...
ZP_01548912   254 -enaAAWIGGALARGERLMGFGHRIYRTRDPRADVLKAGLRLLgadn---pkvrLAEEIEQAALAALKAAKPdRPLETNV 329 Stappia aggreg...
YP_762125     222 -enaERWIDEALARNERLMGFGHRVYRVRDPRADALKTALARLpgts---grigFAEHIERAVLGRLAEKYPrRTLETNV 297 Hyphomonas nep...
Feature 1         #                    #   #               #  #       
2C6X_A        306 EFYAAAVMRAIDFDDELFTPTFSASRMVGWCAHVLEQAENNMIFRPSAQYTG 357 Bacillus subtilis
NP_629955     328 EFYAGVVMELCGLPREMFTPTFAAARVVGWSANILEQASDSKIIRPAARYVG 379 Streptomyces coelicolor A3(2)
jgi:Rxyl_2557 328 EFYTALLLHGLGLPTGLFTPTFAVGRVAGWTAHCLEQRETGRLIRPQSEYVG 379 Rubrobacter xylanophilus DSM 9941
ZP_01172554   315 EYYAAAIMKALKMDSSLFTPTFTAARIAGWTAHVIEQADNNAIFRPESLYIG 366 Bacillus sp. NRRL B-14911
YP_177535     308 EYYAAAIMEALRLKPDWFTPTFCVSRVVGWCSHVIEQSQDNRIMRPQQQYCG 359 Bacillus clausii KSM-K16
YP_001412137  323 EYYTAVLLEALGIPREAVTSVFAMSRIAGWTAHVMEQERVGRLIRPQSKYVG 374 Parvibaculum lavamentivorans DS-1
NP_766823     308 EFFTAILLDALAIPRQAFTPIFAVARAAGWTAHAREQQRTGRLIRPSSSYVG 359 Bradyrhizobium japonicum USDA 110
YP_001546906  312 EFYTALLLHGIDFETDLFTPTFTISRAVGWIAHAFEQRAVGRIIRPQSIYTG 363 Herpetosiphon aurantiacus ATCC 23779
ZP_01548912   330 EFYTAVLLDAIGIDRILFTPLFAVGRTPGWCAHVLEQQETGKLIRPSSHYVG 381 Stappia aggregata IAM 12614
YP_762125     298 EFYTALLLEALGLPREAFTAVFACGRIIGWTAHAREQIGEGRLVRPRSVYRG 349 Hyphomonas neptunium ATCC 15444

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap