Conserved Protein Domain Family
Ec2MCS_like

?
cd06108: Ec2MCS_like 
Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like. 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxalacetate (OAA) to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and OAA to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group contains proteins similar to the E. coli 2MCS, EcPrpC. EcPrpC is one of two CS isozymes in the gram-negative E. coli. EcPrpC is a dimeric (type I ) CS; it is induced during growth on propionate and prefers PrCoA as a substrate though it has partial CS activity with AcCoA. This group also includes Salmonella typhimurium PrpC and Ralstonia eutropha (Re) 2-MCS1 which are also induced during growth on propionate and prefer PrCoA as substrate, but can also use AcCoA. Re 2-MCS1 can use butyryl-CoA and valeryl-CoA at a lower rate. A second Ralstonia eutropha 2MCS, Re 2-MCS2, which is induced on propionate is also found in this group. This group may include proteins which may function exclusively as a CS, those which may function exclusively as a 2MCS, or those with dual specificity which functions as both a CS and a 2MCS.
Statistics
?
PSSM-Id: 99861
View PSSM: cd06108
Aligned: 15 rows
Threshold Bit Score: 655.53
Threshold Setting Gi: 84620822
Created: 18-Oct-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #                                                                            
P31660        20 VALSGVPAGNTALCTVGKSgndLHYRGYDILDLAKHCeFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEA 99  Escherichia col...
YP_344198      8 SGLAGVTAGKTAISTVGKEgkgLTYRGYAIEMLAERAsFEEVAYLLIYGQSPSRAQLTEYREQLRSLRRLPEGLKPVLEA 87  Nitrosococcus o...
NP_859929     11 GGLAGITAGQSAICTVGTGh-gLNYRGYDIYDLARECeFEEVAYLLLKEKLPNANELAAFKKELIAARDLPKALKDTLKL 89  Helicobacter he...
YP_645141      6 VGLSGAIAGDTAICTVGSSgdsLEYRGYPIEELAERAtFEEVMHLLIRGELPDRRQLEEYTGRLSGMRKIPQELRDVLER 85  Rubrobacter xyl...
XP_001023516  10 GGLAGIVAGDSAISTVGIGm-gLNYRGYDIVDLAKNStFEDVAYLILFGKLPTSKQLEEFLDQIVKARYLPAQLKEILER 88  Tetrahymena the...
XP_001447471   8 GGLQGVVAGQSAISTVGVGgigLNYRGYDINDLAYKCnFEEVTYLLLKGHLPNQQQLDELRTLISQKRQIPCKLKQILET 87  Paramecium tetr...
ZP_00367535   11 GGLAGVIAGQSAICTCGLGn-gLNYYGYSIEELAQNAeFEEIAYLLQFGELPNAKELENYKEKIIAQRALSENLKNVLKA 89  Campylobacter c...
NP_819794      6 KGLRGQSAGETSIATVGKEghgLTYRGYRIEDLAANAtFEEVAYLLLKNKLPTKSELDAYTKKLVNLRSLPPALKDTLER 85  Coxiella burnet...
ABX56660       7 EGLEGIIAGKTAISTVGKEgldLTYRGYSIHDLAQNAtFEEVVFLLLYNRLPTRNQLSGFIDQLNSLRELPAALQSVLKL 86  Verrucomicrobia...
ZP_02849616    7 GGLAAVIAGQTRISTVGKEgkgLSYRGYSIYDLARFAaFEETAYLLLYGWLPDAEQLGQFRKQLTASRELPPALISILEL 86  Paenibacillus s...
Feature 1                                                                                        
P31660       100 LPAASHPMDVMRTGVSALGCTLPEkeght---vsgaRDIADKLLASLSSILLYWYHYSHn-GERIQPETDDd-SIGGHFL 174 Escherichia col...
YP_344198     88 LPGNSHPMDVMRTGCSALGCLEPEinr------dqqWDIANRLLALFPSLLLYWYQFHHh-GIRIETDTEEe-SLAGHFL 159 Nitrosococcus o...
NP_859929     90 LPKNAHPMDIMRTTCSMLGCLEPEtydivkmsfpmqNQIAIRLLGIFPSALTFWHHYHHn-GKEISTQSNQd-SIAGHFL 167 Helicobacter he...
YP_645141     86 IPASTHPMEVLRTGCSMLGTLEHEgeg------rdaREIGERLISCLPSVLLYWHHFAGs-GKRIETDTGEh-SLAGHFL 157 Rubrobacter xyl...
XP_001023516  89 IPVDVHPMDMMRTVSSFLGLIEPEtke------ndqYKVAIRLLGIFGPAMAYWYHFAHsgVRINEQTGPKd-TIACNLV 161 Tetrahymena the...
XP_001447471  88 LPKESHPMDIMRTVASLVGILEPEtkp------gqeYEISIRLISLFGPALLYWYHYSNs-GIKINENTGKd-SIAENFL 159 Paramecium tetr...
ZP_00367535   90 IPKEVHPMNLMQTAVAALGALEGEnedf-----sdqDEKIIRLLGILPSMLCYWHHYVNf-GKEIDFDSNQt-SIAGYFL 162 Campylobacter c...
NP_819794     86 IPASSHPMDVMRTGCSMLGNLEPEngf------eneQNIADRLVAIFPAIQCYWYHYSHh-GKRIDTELDDl-TLAGYFL 157 Coxiella burnet...
ABX56660      87 IPQDTNPMDVLRTGCSMLGTLEPEdgh------rtqEHIAKRLLAILPSMLLFWYQYHQg-KGSIETTSESekTIASHLL 159 Verrucomicrobia...
ZP_02849616   87 LPGSAHPMDVLRTGYSALASFEPEeeg------rsaLDIAVRLIGCTSSILLYWYHYQNs-GKRIDTAGSGg-DTASHFL 158 Paenibacillus s...
Feature 1                                  #  #                              ### #  #            
P31660       175 HLLHGEKPs-qSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSAIIGAIGALRGPKHGGANEVSLEIQQRYetpD 253 Escherichia col...
YP_344198    160 NLLHGESPg-aIPRRVLDASLILYAEHEFAASTFAARVTTSTLSDFYSAVTAAIGTLRGTLHGGANEAAMALIERFqepD 238 Nitrosococcus o...
NP_859929    168 ELLHQKPPk-eLWIKAMHASLILYAEHEFNASTFTARVITATMSDVYSGVTGAIGALRGPLHGGANEAAMELIAEYktpQ 246 Helicobacter he...
YP_645141    158 RLLHGREPg-eEERRAVDVSLILYAEHEFNASTFTARIIASTGSDFYSAITGAIGALRGPLHGGANEAAMAFIERFrsaE 236 Rubrobacter xyl...
XP_001023516 162 KLLHLSQTadpLIVRAVDVSLILYAEHDFNASTFAARVTVSTLADFYSGITTAIGTLRGPLHGGANEAVMQYLENIrsiE 241 Tetrahymena the...
XP_001447471 160 KLYHLKSEidpLVVKTFDVSLILYAEHDFAASTFAARVTVSTLSDFYSGITTAIGTLRGPLHGGANEAAMQYLEPLrsiQ 239 Paramecium tetr...
ZP_00367535  163 EKLKLEAPk-eDFIKAMQCSLILYAEHEFNASTFTARICASTKSDIFSAVAAAIGALRGPLHGGANEAAMHLIESFksvE 241 Campylobacter c...
NP_819794    158 HLLLGKKAa-qMAIDCMNASLILYAEHEFNASTFAARVCSATLSDIYSAVTAAIATLRGPLHGGANEAAMDLIMLYktpS 236 Coxiella burnet...
ABX56660     160 HLLYGHPAt-aDQIRALDVALILHAEHEFNASTFTCRVITSTLSDFYSAITGGICALRGPLHGGADEAAMEQISKFhsvE 238 Verrucomicrobia...
ZP_02849616  159 QLLHQTEPg-vQHAKALDVSLTLYAEHEFNASTFAARVTASTLSDFYSAIATGVGTLRGPLHGGANEAAMELIERYgnpD 237 Paenibacillus s...
Feature 1                      ########   #    #                                      # #  # #   
P31660       254 EAEADIRKRVENKEVVIGFGHPVY-TIADPRHQVIKRVAKQLsq---egGSLKMYNIADRLETVMWES-KKMFPNLDWFS 328 Escherichia col...
YP_344198    239 EAEQGVLAALENKEKIMGFGHRVY-KEADPRNAIIKDWCRQLae---raGDSYLFPIAERIEVVMKRE-KGLFPNLDFYI 313 Nitrosococcus o...
NP_859929    247 EAEKGILDKLARKDKIMGFGHRVY-VKADPRNVVIKEWSKKLsed--vgDTKGLYPISEAIEKVMWEQ-KKLFPNLDFYS 322 Helicobacter he...
YP_645141    237 EAERGLREALSRGERLMGFGHPVY-TRVDPRSDIIKGWSRRLse---ghEEGYLYEVSERIERILHEE-KNLFPNLDFYS 311 Rubrobacter xyl...
XP_001023516 242 EANSFLTESFKSKKLIMGFGHRVY-KNGDPRSDIIKEYSKLLaekqpkfGKKILYQISEHIETRVVNE-KKKFPNLDFYS 319 Tetrahymena the...
XP_001447471 240 QADQFLNSRYQSKQLIMGFGHRVY-KKEDPRSPIIKDFSLQLskt--anGDPTLLAVSQHIEKRMIEE-KKIYPNLDFYS 315 Paramecium tetr...
ZP_00367535  242 DAIEGVNKKLENKELLMGFGHRVYgLGGDPRNALIKVWSKHLg------GDDLLFKISEAIEALMKEKrPSLPPNADFYS 315 Campylobacter c...
NP_819794    237 EAIAGIKRKLANKELIMGFGHAVY-RERDPRNAIIKSWAQKLap---naADGYLFDISDAIENTMQDE-KKLFPNLDFYS 311 Coxiella burnet...
ABX56660     239 EAEEGIKAMLSKKEKVMGFGHRVY-KYGDPRSEIIKQWAKNLss---ktGSQVLFSIAEKIEEVMFKE-KHLYPNVDFYS 313 Verrucomicrobia...
ZP_02849616  238 DAEAGILEALRQKQLIMGFGHRVY-SVSDPRSDVIKEWSLALse---qaGDRKLYEISERIEQVMRRE-KKLFPNLDFYS 312 Paenibacillus s...
Feature 1                         #   #               #  #                
P31660       329 AVSYNMMGVPTEMFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRPFVAL 385 Escherichia coli K12
YP_344198    314 APAYRFLGIPVHLYTPLFVCSRVAGWAAHIMEQRADNRLIRPMANYIGPEPRDFVPI 370 Nitrosococcus oceani ATCC 19707
NP_859929    323 ASAYHFMGIPTPYFTPIFIFSRTAGWLAHIFEQRANNKLIRPSSEYIGPDKKAFVPL 379 Helicobacter hepaticus ATCC 51449
YP_645141    312 ASAYRFCGIPTEMFTPLFVFSRTSGWTAHVIEQRESGKIIRPSANYTGPERRPFVPL 368 Rubrobacter xylanophilus DSM 9941
XP_001023516 320 ASTYHQCGIPTELFTPIFVMSRVTGWAAHIFEQRANNKLIRPTSNYTGPQKLSFVPL 376 Tetrahymena thermophila SB210
XP_001447471 316 ASAYKQCGVPTPMFTAIFVISRMTGWGGHLIEQRSNNKLMRPVSDYTGPAKKQFVPI 372 Paramecium tetraurelia strain d4-2
ZP_00367535  316 ASAYHFMGIPTEYFTPIFIMSRVSGWCAHIKEQRANNKLIRPSSEYIGVEPRKFVKI 372 Campylobacter coli RM2228
NP_819794    312 ATAYHFLNIPTKLFTPIFVMSRVTGWCAHIFEQRKDNRIIRPNADYIGPEEQGWVPI 368 Coxiella burnetii RSA 493
ABX56660     314 ALTYHFLGIPTLLFTPLFVISRTAGWCAHIFEQRANNRLIRPIAEYVGPLPMPYIPI 370 Verrucomicrobiae bacterium V4
ZP_02849616  313 ASAYYHLGIPTPLFTPVFVLSRLTGWSAHVMEQRAGNRIIRPSADYIGPDPQEWLPL 369 Paenibacillus sp. JDR-2

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap