Conserved Protein Domain Family

cd06098: phytepsin 
Click on image for an interactive view with Cn3D
Phytepsin, a plant homolog of mammalian lysosomal pepsins.
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA).
PSSM-Id: 133162
Aligned: 25 rows
Threshold Bit Score: 599.358
Threshold Setting Gi: 157336258
Created: 8-Jan-2008
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
  • Comment:The two ASPs at the active site plays key catalytic roles in the pepsin family and conserved for all family members.

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                    #                                                   
Feature 1                                                                                        
Feature 1                                                               #                        
Feature 1                                                                                        
1QDM_C       284 vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirs----vvddepvksnglradpmcsacemav 359 Hordeum vulgare
AAK48494     312 vvcaeckevvseygemiwdllvsglradqvcselglcflngawhessiik------tvvekeaegnltsnplcttcemav 385 sweet potato
BAB20972     312 iasmeckevvyqygdmiwdllvsgvqpdkicsqlalcfndaqflsigiktv-----ierenrknssvaddflctacemav 386 Nepenthes alata
P42211       307 iisteckevvseygemilnlliaqtdpqkvcsqvglcmfdgkrsvsngi---------esvvdkenlgsdamcsvcemav 377 Japanese rice
CAO17344     313 ivsmeckevvsqygnmmwdllvsgvlpskvcsqiglcmasvlwcspgirtv----vekekmesveevgdvvfcnacemia 388 wine grape
CAO70943     313 ivsfncknvvnkygrliwqflvsgfqpenvcsdiglcayngtknarqg----------agmetvigngdnaactfcemia 382 wine grape
ABB87123     313 ivsmecktivsqygemiwdllvsgvrpdqvcsqaglcfvdgaqhvssnirt-----vveretegssvgeaplctacemav 387 potato
NP_001042785 306 ivsmeckqvvrdygdmilemliaqaspmklcsqiglcafdgtrsvrnni---------esvvdkekvgsdlsctacemav 376 Japanese rice
ABI78942     310 nhaigaegvvsteckeivsqygnmiwdllvsgvkpdevcsqvglcffngaagsnigmvvekdnegksssdpmctacemav 389 sweet potato
CAB40349     315 vlnqqcktlvgqygknmiqmltsevqpdkicshmklctfdgahdvrsmie-------svvdknndkssggeictfcemal 387 wild artichoke
AAK48494     312 vvcaeckevvseygemiwdllvsglradqvcselglcflngawhessiik------tvvekeaegnltsnplcttcemav 385 sweet potato
BAB20972     312 iasmeckevvyqygdmiwdllvsgvqpdkicsqlalcfndaqflsigiktv-----ierenrknssvaddflctacemav 386 Nepenthes alata
P42211       307 iisteckevvseygemilnlliaqtdpqkvcsqvglcmfdgkrsvsngi---------esvvdkenlgsdamcsvcemav 377 Japanese rice
CAO17344     313 ivsmeckevvsqygnmmwdllvsgvlpskvcsqiglcmasvlwcspgirtv----vekekmesveevgdvvfcnacemia 388 wine grape
CAO70943     313 ivsfncknvvnkygrliwqflvsgfqpenvcsdiglcayngtknarqg----------agmetvigngdnaactfcemia 382 wine grape
ABB87123     313 ivsmecktivsqygemiwdllvsgvrpdqvcsqaglcfvdgaqhvssnirt-----vveretegssvgeaplctacemav 387 potato
NP_001042785 306 ivsmeckqvvrdygdmilemliaqaspmklcsqiglcafdgtrsvrnni---------esvvdkekvgsdlsctacemav 376 Japanese rice
ABI78942     310 nhaigaegvvsteckeivsqygnmiwdllvsgvkpdevcsqvglcffngaagsnigmvvekdnegksssdpmctacemav 389 sweet potato
CAB40349     315 vlnqqcktlvgqygknmiqmltsevqpdkicshmklctfdgahdvrsmie-------svvdknndkssggeictfcemal 387 wild artichoke
Feature 1                                                                                        
1QDM_C       360 vwmqnqlaqnktqdlildyvnqlcnrlpspmgeSAVDCGSLGSMPDIEFTIggKKFALKPEEYILKVGEGAAAQCISGFT 439 Hordeum vulgare
AAK48494     386 iwlqnqlkqkgikekvfeyvdqlceklpspdgeSVIDCNSISSMPNVTFVIgdKDFVLTPEQYILKTGEGIAAVCVSGFL 465 sweet potato
BAB20972     387 vwiqnqlrrevtkekvlnyinelcdslpspmgeSVIDCDSIPYMPNVTFTIgeKPFKLTPEQYVLKAGEGDAMVCLSGFI 466 Nepenthes alata
P42211       378 vwienqlrenktkelilnyanqlcerlpspngeSTVSCHQISKMPNLAFTIanKTFILTPEQYIVKLEQGGQTVCISGFM 457 Japanese rice
CAO17344     389 vwiqsqlkqmktkdkvlryvtelcgslpspmgeSVIDCTSVANMPNITFIIgdKAFDLTPDQYILRTGDGSATVCLSGFT 468 wine grape
CAO70943     383 fwiqvqlkehkakekvfqyvnelcenlpnpggkDFVNCDALATMPVISFAIgdKYFPLTAEQYTLKVEVNCTTVCLSGFT 462 wine grape
ABB87123     388 vwmqnqlkqagtkekvleyvnqlcekipspmgeSTIDCNSISSMPDISFTIkdKAFVLTPEQYILKTGEGVATICVSGFA 467 potato
NP_001042785 377 vwiqnqlrhnqtrelilqyadqlcerlpspngeSAVDCDEISNMPNLSFTIanKTFTLTPEQYVVKLEQQGQTVCISGFM 456 Japanese rice
ABI78942     390 vwmqnqlkqkvvkekvfdyvnqlcekipspmgeSTIDCNSISNMPNVTFKIadKDFVLTPEQYILKTGEGVATICVSGFL 469 sweet potato
CAB40349     388 vrmqneikrnetedniinhvnevcdqlptssaeSIVDCNGISSMPNIAFTIgsKLFEVTPEQYIYKVGEGEAATCISGFT 467 wild artichoke
AAK48494     386 iwlqnqlkqkgikekvfeyvdqlceklpspdgeSVIDCNSISSMPNVTFVIgdKDFVLTPEQYILKTGEGIAAVCVSGFL 465 sweet potato
BAB20972     387 vwiqnqlrrevtkekvlnyinelcdslpspmgeSVIDCDSIPYMPNVTFTIgeKPFKLTPEQYVLKAGEGDAMVCLSGFI 466 Nepenthes alata
P42211       378 vwienqlrenktkelilnyanqlcerlpspngeSTVSCHQISKMPNLAFTIanKTFILTPEQYIVKLEQGGQTVCISGFM 457 Japanese rice
CAO17344     389 vwiqsqlkqmktkdkvlryvtelcgslpspmgeSVIDCTSVANMPNITFIIgdKAFDLTPDQYILRTGDGSATVCLSGFT 468 wine grape
CAO70943     383 fwiqvqlkehkakekvfqyvnelcenlpnpggkDFVNCDALATMPVISFAIgdKYFPLTAEQYTLKVEVNCTTVCLSGFT 462 wine grape
ABB87123     388 vwmqnqlkqagtkekvleyvnqlcekipspmgeSTIDCNSISSMPDISFTIkdKAFVLTPEQYILKTGEGVATICVSGFA 467 potato
NP_001042785 377 vwiqnqlrhnqtrelilqyadqlcerlpspngeSAVDCDEISNMPNLSFTIanKTFTLTPEQYVVKLEQQGQTVCISGFM 456 Japanese rice
ABI78942     390 vwmqnqlkqkvvkekvfdyvnqlcekipspmgeSTIDCNSISNMPNVTFKIadKDFVLTPEQYILKTGEGVATICVSGFL 469 sweet potato
CAB40349     388 vrmqneikrnetedniinhvnevcdqlptssaeSIVDCNGISSMPNIAFTIgsKLFEVTPEQYIYKVGEGEAATCISGFT 467 wild artichoke
Feature 1                                             
BAB20972     467 ALDVPppSGPLWILGDVFMGVYHTVFDFGnlKLGFAE 503 Nepenthes alata
P42211       458 AFDIPppRGPLWILGDVFMGAYHTVFDFGkdRIGFAK 494 Japanese rice
NP_001042785 457 AFDVPppRGPLWILGDVFMAAYHTVFDFGknRIGFAE 493 Japanese rice
CAB40349     468 ALDIMspQGPIWILGDMFMGPYHTVFDYGklRVGFAE 504 wild artichoke
BAB20972     467 ALDVPppSGPLWILGDVFMGVYHTVFDFGnlKLGFAE 503 Nepenthes alata
P42211       458 AFDIPppRGPLWILGDVFMGAYHTVFDFGkdRIGFAK 494 Japanese rice
NP_001042785 457 AFDVPppRGPLWILGDVFMAAYHTVFDFGknRIGFAE 493 Japanese rice
CAB40349     468 ALDIMspQGPIWILGDMFMGPYHTVFDYGklRVGFAE 504 wild artichoke

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap