1QDM,1QDM


Conserved Protein Domain Family
phytepsin

?
cd06098: phytepsin 
Click on image for an interactive view with Cn3D
Phytepsin, a plant homolog of mammalian lysosomal pepsins.
Phytepsin, a plant homolog of mammalian lysosomal pepsins, resides in grains, roots, stems, leaves and flowers. Phytepsin may participate in metabolic turnover and in protein processing events. In addition, it highly expressed in several plant tissues undergoing apoptosis. Phytepsin contains an internal region consisting of about 100 residues not present in animal or microbial pepsins. This region is thus called a plant specific insert. The insert is highly similar to saponins, which are lysosomal sphingolipid-activating proteins in mammalian cells. The saponin-like domain may have a role in the vacuolar targeting of phytepsin. Phytepsin, as its animal counterparts, possesses a topology typical of all aspartic proteases. They are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA).
Statistics
?
PSSM-Id: 133162
View PSSM: cd06098
Aligned: 25 rows
Threshold Bit Score: 599.358
Threshold Setting Gi: 157336258
Created: 8-Jan-2008
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 2 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
Evidence:
  • Comment:The two ASPs at the active site plays key catalytic roles in the pepsin family and conserved for all family members.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                    #                                                   
1QDM_C        44 VALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKPAAIQYGTGSIAG 123 Hordeum vulgare
AAK48494      72 VSLNNYLDAQYYGEISIGSPPQNFTVIFDTGSSNLWVPSSKCYLSIACYFHSKYKSSKSSTYTQIGKSCSITYGSVSISG 151 sweet potato
BAB20972      72 VYLKNYLDAQYYGEIGIGSPPQKFSVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSKSSTYTKIGKSCEIDYGSGSISG 151 Nepenthes alata
P42211        67 VPLVDYLNTQYYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYNSKKSSSYKADGETCKITYGSGAISG 146 Japanese rice
CAO17344      73 VSLKNYLDAQYFGEIGIGTPPQNFTVVFDTGSSNLWVPSSKCYFSIACFFHNKYKARLSSTYTKIGRPGEIHYGSGSISG 152 wine grape
CAO70943      73 VYLKNYMDAQYYGEIGIGSPPQTFSVVFDTGSSNLWVPSSKCYFSIACYFHARYRAVLSRTYSKNGRHCKINYGSGSISG 152 wine grape
ABB87123      73 VPLKNYLDAQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSKCYFSIACWIHSKYKASKSSTYTRDGESCSIRYGTGSISG 152 potato
NP_001042785  66 VPLDNYLDTQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSVKCYFSIACYLHHRYKSKGSSSYKKNGESCSISYGSGSIAG 145 Japanese rice
ABI78942      70 VSLKNYLDAQYYGEISIGSPPQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSKSSTYTKIGTSCSITYGSGSISG 149 sweet potato
CAB40349      75 VALTNDRDTAYYGEIGIGTPPQNFAVIFDTGSSDLWVPSTKCDTSLACVIHPRYDSGDSSTYKGNGTTASIQYGTGAIVG 154 wild artichoke
Feature 1                                                                                        
1QDM_C       124 YFSeDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEG 203 Hordeum vulgare
AAK48494     152 FLSqDDVQLGDLLVKDQVFIETTREPSLTFIIAKFDGILGLGFQEISVENVVPVWYDMVEQGLVDEPVFSFWLNRDPKAE 231 sweet potato
BAB20972     152 FFSqDIVEVGNLAVKNQVFIEASREKSLTFALAKFDGILGLGFQEISVGDVVPVWYNMVEQGLVSEKVFSFWFNRDPKAK 231 Nepenthes alata
P42211       147 FFSkDNVLVGDLVVKNQKFIEATRETSVTFIIGKFDGILGLGYPEISVGKAPPIWQSMQEQELLADDVFSFWLNRDPDAS 226 Japanese rice
CAO17344     153 FFSqDNVEVGSLVVKDQVFIEATREGSLTFALAKFDGIMGLGFQGISVGNATPVWSTMLQQGLLHEELFSFWLNRNPNAN 232 wine grape
CAO70943     153 FFSqDHVQIGEIVIKNQVFTEATKEGLFAFSLAQFDGILGLGFQNASVGKIPPIWYNMVQQSLVSMEIVSFWLNRDPKAK 232 wine grape
ABB87123     153 HFSmDNVQVGDLVVKDQVFIEATREPSITFIVAKFDGILGLGFQEISVGNTTPVWYNMVGQGLVKESVFSFWFNRDANAK 232 potato
NP_001042785 146 FFSeDSVLVGDLAVKNQMFIETTREPSLTFIIGKFDGILGLGFPEISVGGAPPIWQGMKEQQLIEKDVFSFWLNRDPDAP 225 Japanese rice
ABI78942     150 FLSqDNVGVGDLVVKDQVFIETTKEPSLTFVLAKFDGLLGLGFQEISVEDVVPVWYNMVEQGLVDEPVFSFWLNRDTNAE 229 sweet potato
CAB40349     155 FYSqDSVEVGDLVVEHQDFIETTEEDDTVFLKSEFDGILGLGFQEISAGKAVPVWYNMVNQGLVEEAVFSFWLNRNVDEE 234 wild artichoke
Feature 1                                                               #                        
1QDM_C       204 eGGEIIFGGMDPKHYVGEHTYVPVTQKgYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINekigaag 283 Hordeum vulgare
AAK48494     232 vGGELVFGGVDPKHFKGEHTYVPVTQKgYWQIDLGDFLIGNSSTGYCEGGCAVIVDSGTSLLTGPTAVVTEINyaigpeg 311 sweet potato
BAB20972     232 iGGEIVFGGIDEKHFVGEHIYVPITRKgYWQFEMGNFLIGNYSTGFCRGGCDAIVDSGTSLLAGPMHVVTEVNhaigaeg 311 Nepenthes alata
P42211       227 sGGELVFGGMDPKHYKGDHTYVPVSRKgYWQFNMGDLLIDGHSTGFCAKGCAAIVDSGTSLLAGPTAIVAQVNhaigaeg 306 Japanese rice
CAO17344     233 eGGEIVFGGVDKRHFRGKHTFVPVTQAgYWQFRMGDFLISNQTTGVCEGGCSAIVDSGTSLIAGPTLVVTQINhaigaeg 312 wine grape
CAO70943     233 iGGEVIFGGVDWRHFMGDHTFVPITRKdYWQIEVGDILIAGSSTGFCEGGCAAIVDTGTSMIAGPTTVVTQINhaigaeg 312 wine grape
ABB87123     233 eGGELVFGGVDPKHFKGNHTYVPLTQKgYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAGPTTIVTQINhaigaeg 312 potato
NP_001042785 226 tGGELIFGGVDPNHYKGSHTYVPVTRKgYWQFEMGDLLIDDYSTGFCSGGCAAIADSGTSLLGGPTTIVAQINhaigaeg 305 Japanese rice
ABI78942     230 eGGELIFGGVDPNHFKGKHTYVPVTQKgYWQFEMGDFLIGNSSTGFCEGGCAAIVDSGTSLLTGPTTIVTEINhaivtei 309 sweet potato
CAB40349     235 eGGELVFGGVDPNHFRGNHTYVPVTRKgYWQFEMGDVLIGDKSSGFCAGGCAAIADSGTSFFAGPTAIITQINqaigakg 314 wild artichoke
Feature 1                                                                                        
1QDM_C       284 vvsqecktivsqygqqildlllaetqpkkicsqvglctfdgtrgvsagirs----vvddepvksnglradpmcsacemav 359 Hordeum vulgare
AAK48494     312 vvcaeckevvseygemiwdllvsglradqvcselglcflngawhessiik------tvvekeaegnltsnplcttcemav 385 sweet potato
BAB20972     312 iasmeckevvyqygdmiwdllvsgvqpdkicsqlalcfndaqflsigiktv-----ierenrknssvaddflctacemav 386 Nepenthes alata
P42211       307 iisteckevvseygemilnlliaqtdpqkvcsqvglcmfdgkrsvsngi---------esvvdkenlgsdamcsvcemav 377 Japanese rice
CAO17344     313 ivsmeckevvsqygnmmwdllvsgvlpskvcsqiglcmasvlwcspgirtv----vekekmesveevgdvvfcnacemia 388 wine grape
CAO70943     313 ivsfncknvvnkygrliwqflvsgfqpenvcsdiglcayngtknarqg----------agmetvigngdnaactfcemia 382 wine grape
ABB87123     313 ivsmecktivsqygemiwdllvsgvrpdqvcsqaglcfvdgaqhvssnirt-----vveretegssvgeaplctacemav 387 potato
NP_001042785 306 ivsmeckqvvrdygdmilemliaqaspmklcsqiglcafdgtrsvrnni---------esvvdkekvgsdlsctacemav 376 Japanese rice
ABI78942     310 nhaigaegvvsteckeivsqygnmiwdllvsgvkpdevcsqvglcffngaagsnigmvvekdnegksssdpmctacemav 389 sweet potato
CAB40349     315 vlnqqcktlvgqygknmiqmltsevqpdkicshmklctfdgahdvrsmie-------svvdknndkssggeictfcemal 387 wild artichoke
Feature 1                                                                                        
1QDM_C       360 vwmqnqlaqnktqdlildyvnqlcnrlpspmgeSAVDCGSLGSMPDIEFTIggKKFALKPEEYILKVGEGAAAQCISGFT 439 Hordeum vulgare
AAK48494     386 iwlqnqlkqkgikekvfeyvdqlceklpspdgeSVIDCNSISSMPNVTFVIgdKDFVLTPEQYILKTGEGIAAVCVSGFL 465 sweet potato
BAB20972     387 vwiqnqlrrevtkekvlnyinelcdslpspmgeSVIDCDSIPYMPNVTFTIgeKPFKLTPEQYVLKAGEGDAMVCLSGFI 466 Nepenthes alata
P42211       378 vwienqlrenktkelilnyanqlcerlpspngeSTVSCHQISKMPNLAFTIanKTFILTPEQYIVKLEQGGQTVCISGFM 457 Japanese rice
CAO17344     389 vwiqsqlkqmktkdkvlryvtelcgslpspmgeSVIDCTSVANMPNITFIIgdKAFDLTPDQYILRTGDGSATVCLSGFT 468 wine grape
CAO70943     383 fwiqvqlkehkakekvfqyvnelcenlpnpggkDFVNCDALATMPVISFAIgdKYFPLTAEQYTLKVEVNCTTVCLSGFT 462 wine grape
ABB87123     388 vwmqnqlkqagtkekvleyvnqlcekipspmgeSTIDCNSISSMPDISFTIkdKAFVLTPEQYILKTGEGVATICVSGFA 467 potato
NP_001042785 377 vwiqnqlrhnqtrelilqyadqlcerlpspngeSAVDCDEISNMPNLSFTIanKTFTLTPEQYVVKLEQQGQTVCISGFM 456 Japanese rice
ABI78942     390 vwmqnqlkqkvvkekvfdyvnqlcekipspmgeSTIDCNSISNMPNVTFKIadKDFVLTPEQYILKTGEGVATICVSGFL 469 sweet potato
CAB40349     388 vrmqneikrnetedniinhvnevcdqlptssaeSIVDCNGISSMPNIAFTIgsKLFEVTPEQYIYKVGEGEAATCISGFT 467 wild artichoke
Feature 1                                             
1QDM_C       440 AMDIPppRGPLWILGDVFMGPYHTVFDYGklRIGFAK 476 Hordeum vulgare
AAK48494     466 ALDVPppQGPLWILGDVFMGAYHTVFDYGnlQVGFAE 502 sweet potato
BAB20972     467 ALDVPppSGPLWILGDVFMGVYHTVFDFGnlKLGFAE 503 Nepenthes alata
P42211       458 AFDIPppRGPLWILGDVFMGAYHTVFDFGkdRIGFAK 494 Japanese rice
CAO17344     469 ALDVPppKGPLWILGEIFMGVYHTVFDFGdlRIGFAE 505 wine grape
CAO70943     463 ALDVPrpDGPLWVLGDVFLGAYHTIFDFGnlQVGFAK 499 wine grape
ABB87123     468 ALDVPppRGPLWILGDVFMGPYHTVFDYGksQVGFAE 504 potato
NP_001042785 457 AFDVPppRGPLWILGDVFMAAYHTVFDFGknRIGFAE 493 Japanese rice
ABI78942     470 AMDVPapRGPLWILGDVFMGVYHTVFDYGnlQIGFAE 506 sweet potato
CAB40349     468 ALDIMspQGPIWILGDMFMGPYHTVFDYGklRVGFAE 504 wild artichoke

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap