Conserved Protein Domain Family
Plasmepsin_5

?
cd06096: Plasmepsin_5 
Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite.
The family contains a group of aspartic proteinases homologous to plasmepsin 5. Plasmepsins are a class of at least 10 enzymes produced by the plasmodium parasite. Through their haemoglobin-degrading activity, they are an important cause of symptoms in malaria sufferers. This family of enzymes is a potential target for anti-malarial drugs. Plasmepsins are aspartic acid proteases, which means their active site contains two aspartic acid residues. These two aspartic acid residue act respectively as proton donor and proton acceptor, catalyzing the hydrolysis of peptide bond in proteins. Aspartic proteinases are composed of two structurally similar beta barrel lobes, each lobe contributing an aspartic acid residue to form a catalytic dyad that acts to cleave the substrate peptide bond. The catalytic Asp residues are contained in an Asp-Thr-Gly-Ser/thr motif in both N- and C-terminal lobes of the enzyme. There are four types of plasmepsins, closely related but varying in the specificity of cleavage site. The name plasmepsin may come from plasmodium (the organism) and pepsin (a common aspartic acid protease with similar molecular structure). This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA).
Statistics
?
PSSM-Id: 133160
View PSSM: cd06096
Aligned: 12 rows
Threshold Bit Score: 338.199
Threshold Setting Gi: 126644067
Created: 10-Jan-2008
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:catalytic residue [active site]
Evidence:
  • Comment:The two ASPs at the active site plays key catalytic roles in the pepsin family and conserved for all family members.
  • Comment:Predicted based on homologous proteins woth structures.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                              #                                                         
XP_955372     79 FAFYYIYMGIGNPk-vKQMLIIDTGSQQINVACg---nSPSCGKHsldnynyqnsvtykpidc----------------- 137 Theileria annul...
XP_001388163  35 NGYYFINAFVGNPp-qKQTLILDSGSSQISFTCi---tCINCGSHeyppfdimksitg---------------------- 88  Cryptosporidium...
XP_625810     31 YGYYFIKVNVGFPitqQQTLIIDTGSSLTGFACs---dCINCGTHenkpfninlsdtsniikckrnntpnnetdiinksi 107 Cryptosporidium...
XP_677725     52 YAYYFMDINIGTPg-qKLSLIVDTGSSSLSFPCs---eCKDCGVHmenpfnlnnsstssily------------------ 109 Plasmodium berg...
XP_729942     88 YAYYFMDIEIGTPg-qKLSLIVDTGSSSLSFPCs---eCKDCGIHmenpfnlnnsstssvly------------------ 145 Plasmodium yoel...
AAW71464      97 YAYYFLDIDIGKPs-qRISLILDTGSSSLSFPCn---gCKDCGIHmekpynlnysktssily------------------ 154 malaria parasit...
AAS99528      59 YAYYFLDIDIGTPe-qRISLILDTGSSSLSFPCa---gCKNCGVHmenpfnlnnsktssily------------------ 116 malaria parasit...
XP_001441493  31 LGYYFVNIYVGNPp-qRQSVIIDTGSSITAFPCdacdqTKSCGIHldqyyirnnsstqeeld------------------ 91  Paramecium tetr...
XP_001447356  41 LGYYYMNIYIGENm-tKHSVIVDTGSQATTINCn---qCHQCGQHqnppysfneknynss-------------------- 96  Paramecium tetr...
AAW71466     104 YAYYFLDIDIGKPs-qRISLILDTGSSSLSFPCn---gCKDCGIHmekpynlnysktssily------------------ 161 malaria parasit...
XP_665895     39 TAYYYSDIFIGLPepqRQSVILDTGSNLLAFSSt---qCQQCGTHldayydpfksitkrev------------------- 96  Cryptosporidium...
XP_001388183  39 TAYYYSDIFVGLPepqRQSVILDTGSNLLAFSSt---qCQQCGTHldayydpfksitkrev------------------- 96  Cryptosporidium...
Feature 1                                                                                        
XP_955372    138 --esdsckiieggcdlersCIFSETYSEGSNVKGMYIGDLVSFdtdeds-----sdlssfFDYIGCVTHEsaMIRSQITN 210 Theileria annul...
XP_001388163  89 -------kncnrkllggekCKYFHRFNEGSVISGKYFSDTLRFeevqqnsgiikdhfeikYDYLGCNELEtkKIYRQRAT 161 Cryptosporidium...
XP_625810    108 hgrismnypnynksflnnkCVYDIKYSEGSRILGYFFEDFVEFenklssnl-eirqkfknKFVFGCNIIEnnFFKFQKAS 186 Cryptosporidium...
XP_677725    110 ---cndnicpynlkcvkgrCEYLQSYCEGSRINGFYFSDIVRLesnnntk----ngnitfKKHMGCHMHEegLFLHQHAT 182 Plasmodium berg...
XP_729942    146 ---cndntcpynlkcvkgrCEYLQSYCEGSRINGFYFSDVVKLestnntk----sgnitfKKHMGCHMHEegLFLYQHAT 218 Plasmodium yoel...
AAW71464     155 ---cnksncpyglkcvgnkCEYLQSYCEGSQIYGFYFSDIVTLpsynnk------kkisfEKLMGCHMHEesLFLHQQAT 225 malaria parasit...
AAS99528     117 ---ceneecpfklncvkgkCEYMQSYCEGSQISGFYFSDVVSVvsynn-------ervtfRKLMGCHMHEesLFLYQQAT 186 malaria parasit...
XP_001441493  92 --cksqfgectclrclnqqCIFSISYSEGSHLEGFYLKDQVIFgdllm-------eansvTSVFGCTTREtnLFKTQQAN 162 Paramecium tetr...
XP_001447356  97 ----dlridfncssfendrCNFASYYVEGSSIAGFYFKDKVLIgdgliqlddryieqesfESILGCTQFEtgQLYQQMAD 172 Paramecium tetr...
AAW71466     162 ---cnksncpyglkcvgnkCEYLQSYCEGSQIYGFYFSDIVTLpsynnk------kkisfEKLMGCHMHEesLFLHQQAT 232 malaria parasit...
XP_665895     97 ----pchsyckvcvnnkkqCAYTIHYLEGSSLSGSYFEDFVAIrnekginsepspyvvglSTIFGGITHEtnLFFTQAAS 172 Cryptosporidium...
XP_001388183  97 ----pchsyckvcvnnkkqCAYTIHYLEGSSLSGSYFEDFVAIrnekgvnsepspyvvglSTIFGGITHEtnLFFTQAAS 172 Cryptosporidium...
Feature 1                                                                                        
XP_955372    211 GILGLSRSDKNPLIKNEYyesqsFIEKYLTdhfs--prhkIFSLCLSedGGVLTLGGYdkdldm---------------- 272 Theileria annul...
XP_001388163 162 GVFGIGLKSSLDDHVNIIn---sLLTSLESntnikgsnnlVISICLLysGGRIVIGEQdekitnrns------------- 225 Cryptosporidium...
XP_625810    187 GIMGLANFSNKEMNQIINy----IFKSGEVrktd---sdkIISIFFEkdGGKLTFGSTcfdqtkmm-------------- 245 Cryptosporidium...
XP_677725    183 GVLGLSLTKPKGVPTFIDl----LFKSSPKln-------kIFSLCISeyGGELILGGYskdyivkevsidekkdni---- 247 Plasmodium berg...
XP_729942    219 GVLGLSLTKPKGVPTFIDl----LFKNSPKln-------kIFSLCISeyGGELILGGYskdyivkevsidekkeniednk 287 Plasmodium yoel...
AAW71464     226 GVLGFSLTKPNGVPTFVDl----LFKHTPSlk-------pIYSICVSehGGELIIGGYepdyflsnqkekqkmdksdnns 294 malaria parasit...
AAS99528     187 GVLGMSLSKPQGIPTFVNl----LFDNAPQlk-------qVFTICISenGGELIAGGYdpayivrrggsksvsgqgsgp- 254 malaria parasit...
XP_001441493 163 GIMGLSPKTNTSLAFPNIvd--dIHTQHNGmn-------lFFAICIGriDGYMTIGQYdysrhq---------------- 217 Paramecium tetr...
XP_001447356 173 GIFGLAPINNHSQYPPSLi---dFIAKKDKals----lkrRFSICLNddYGYISVGGYdllrqd---------------- 229 Paramecium tetr...
AAW71466     233 GVLGFSLTKPNGVPTFVDl----LFKHTPSlk-------pIYSICVSehGGELIIGGYepdyflsnqkekqkmdksdnns 301 malaria parasit...
XP_665895    173 GILGLAYTASSQERAPLFq----TWTKRSKyak-----daILSLCFSseGGMISFGGYnseywvlgsndksfrstseanl 243 Cryptosporidium...
XP_001388183 173 GILGLAYTASSQERAPLFq----TWTKRSKyak-----daILSLCFSseGGMISFGGYnseywvlgsndksfrstsesnl 243 Cryptosporidium...
Feature 1                                                                                       #
XP_955372    273 ---------------------------lvkkksDMIWTPMVks-eFYIVRVfrftiddd---------vtdvnrkNFVLD 315 Theileria annul...
XP_001388163 226 -------------------------nfsenkrnHVYWVPIIypsnVYKVSLeglsigsgkf-----slleeetslFAIVD 275 Cryptosporidium...
XP_625810    246 --------------------------nypfenyNITRCINDerycAYISKIevdsntrel------dtklnerlfKAIFD 293 Cryptosporidium...
XP_677725    248 ----------------ehnkneninsinksivdGILWEAITrk-yYYYIRVkgfqlfgtt-------fshnnksmEMLVD 303 Plasmodium berg...
XP_729942    288 ------------nenidsidksveinknkssvdDILWEAITrk-yYYYIRVegfqlfgtt-------fshnnksmEMLVD 347 Plasmodium yoel...
AAW71464     295 snkgnvsiklknndknddeennskdvivsnnveDIVWQAITrk-yYYYIKIygldlygt--------nimdkkelDMLVD 365 malaria parasit...
AAS99528     255 -------------vseslsesgedpqvalreaeKIVWENVTrk-yYYYIKVrgldmfgtn-------mmssskglEMLVD 313 malaria parasit...
XP_001441493 218 ---------------------------knsayyTIQYMHTQnk-pVYGVKIsqikvhnkti----lagadlqsggGSFID 265 Paramecium tetr...
XP_001447356 230 ---------------------------pdfkinKIKFKPTQ----QYQVNLtkiafgdqtft---vnnkiytggqGTFID 275 Paramecium tetr...
AAW71466     302 snkgnvsiklknndknddeennskdvivsnnveDIVWQAITrk-yYYYIKIygldlygt--------nimdkkelDMLVD 372 malaria parasit...
XP_665895    244 fera----lgysflssssnsqsrsnsrgnnldsKIGWTPLSilngNYYVQLtkvsvyqtkltlhkdsssgntkpiPLVID 319 Cryptosporidium...
XP_001388183 244 fera----lgysflssssnsqsrsnsrgnnldsKIGWTPLSilngNYYVQLtkvsvyqtkltlhkdsssgntkpiPLVID 319 Cryptosporidium...
Feature 1                                                                                        
XP_955372    316 TGTTLSTFEKELFIKIEKPIkeacyqnkkfskikktnie----------------------------------------- 354 Theileria annul...
XP_001388163 276 VGSTYSFFPSNLYNKIINKFsklcellnkldinkcit------------------------------------------- 312 Cryptosporidium...
XP_625810    294 TGTTISIFPARLFKKITRGLfnnvskyypkisghdekdglt--------------------------------------- 334 Cryptosporidium...
XP_677725    304 SGSTFTHLPDDLYNNLNFFFdilcihnmnnpidiekklkitnetlsnhllyfd--------------------------- 356 Plasmodium berg...
XP_729942    348 SGSTFTHLPDDLYNNLNFFFdilcihnmnnpidiekrlkitnetlskhllyfd--------------------------- 400 Plasmodium yoel...
AAW71464     366 SGSTFTHIPENIYNQINYYLdilcihdmtniyeinkrlkltneslnkplvyfe--------------------------- 418 malaria parasit...
AAS99528     314 SGSTFTHIPEDLYNKLNYFFdilciqdmnnaydvnkrlkmtnesfnnplvqfd--------------------------- 366 malaria parasit...
XP_001441493 266 SGSTLVNAHPDVTRALVNFFvcesancpqmqfnddlac------------------------------------------ 303 Paramecium tetr...
XP_001447356 276 SGATISYMDREIYSQLVQSIkdhfelnkapittilqs------------------------------------------- 312 Paramecium tetr...
AAW71466     373 SGSTFTHIPENIYNQINYYLdilcihdmtniyeinkrlkltneslnkplvyfe--------------------------- 425 malaria parasit...
XP_665895    320 SGTTLSYFPEHIFIQILNVInqriaetenkstfrslieagskfleytglkssssqnelelgikqisifpgevpgaallrk 399 Cryptosporidium...
XP_001388183 320 SGTTLSYFPEHIFIQILNVInqriaetenkstfrslieagskfleytglkssssqnelelgikqisifpgeipgaallrk 399 Cryptosporidium...
Feature 1                                                                                        
XP_955372        --------------------------------------------------------------------------------     Theileria annul...
XP_001388163     --------------------------------------------------------------------------------     Cryptosporidium...
XP_625810    335 ------------------------------------------------------------------------------cw 336 Cryptosporidium...
XP_677725    357 -------------------------------------------------------------------dfkstlkniisse 369 Plasmodium berg...
XP_729942    401 -------------------------------------------------------------------dfkstlkniiste 413 Plasmodium yoel...
AAW71464     419 -------------------------------------------------------------------dfktalkniiqne 431 malaria parasit...
AAS99528     367 -------------------------------------------------------------------dfrkslksiiake 379 malaria parasit...
XP_001441493     --------------------------------------------------------------------------------     Paramecium tetr...
XP_001447356     --------------------------------------------------------------------------------     Paramecium tetr...
AAW71466     426 -------------------------------------------------------------------dfktalkniiqne 438 malaria parasit...
XP_665895    400 rvyrrlnniedivntfnstvhpenfsdediessnnqlnnsnevsnhfnqtttstttstintlfssqefdidssvsrimle 479 Cryptosporidium...
XP_001388183 400 rvyrrlnniedivntfnstvhpenftnediessnnqlnnsnevsnhfnqtttstttstintlfssqefdidssvsrimle 479 Cryptosporidium...
Feature 1                                                                                        
XP_955372    355 -ckvdevngkicfsditklPIITINFen-gTNFDWKPESYMIDRtvkrti------------------ndyswWCLGIee 414 Theileria annul...
XP_001388163 313 --inqslcfsdpaklhallPIMNIKFggqpNLIKWIHSSYLIKRerawc--------------------vgikEQTSYq- 369 Cryptosporidium...
XP_625810    337 rmlngistdkfpnikvvfnNNRNKLTe--qLVINWPPESYLYLNkilegnikvyclgiasnnlinseigadknGENSSs- 413 Cryptosporidium...
XP_677725    370 nvcvkiadnvqcwrylenlPNIYIKLsn-nTKLVWQPSSYLYKKesfw----------------------ckgLEKQVn- 425 Plasmodium berg...
XP_729942    414 nvcvkiadnvqcwrylkhlPNIYIKLsn-nTKLLWQPSSYLYKKesfw----------------------ckgLEKQVn- 469 Plasmodium yoel...
AAW71464     432 nlcikivdgvqcwkslenlPNLYITLsn-nYKMIWKPSSYLYKKesfw----------------------ckgLEKQVn- 487 malaria parasit...
AAS99528     380 nmcvkivdgvqcwkyleglPDLFVTLsn-nYKMKWQPHSYLYKKesfw----------------------ckgIEKQVn- 435 malaria parasit...
XP_001441493 304 -yvynktlhgsfeqfisffPTYQFIMen-nFIFDWTPRDYLTKDmvqhda------------------yclpvAGYSGs- 362 Paramecium tetr...
XP_001447356 313 --qvcfkftqdvldqysyfPTIKFIFdd-dVEIYWKPQEYLNIQenq-----------------------vciGVERLs- 365 Paramecium tetr...
AAW71466     439 nlcikivdgvqcwkslenlPNLYITLsn-nYKMIWKPSSYLYKKesfw----------------------ckgLEKQVn- 494 malaria parasit...
XP_665895    480 tskgercwklrdpnemsrfPTITLGFp--gLKVEWEPAQYLYKKyrnt----------------------yclGFDSDk- 534 Cryptosporidium...
XP_001388183 480 tskgercwklrdpnemsrfPTITLGFp--gLKVEWEPAQYLYKKyrnt----------------------yclGFDSDk- 534 Cryptosporidium...
Feature 1                                           
XP_955372    415 sktNENIFGANFFKNNHVVFNLdkeLIGISHGNCP 449 Theileria annulata strain Ankara
XP_001388163 370 ---NHIILGVSFMKKRQIILDPrkkRIGFNLNTTA 401 Cryptosporidium parvum Iowa II
XP_625810    414 ---NEIILGATFFIYKEITFILnenKIMIRYNYLN 445 Cryptosporidium parvum Iowa II
XP_677725    426 ---DKPILGLSFFKNKQIIFDLknnKIGFIESNCP 457 Plasmodium berghei strain ANKA
XP_729942    470 ---NKPILGLSFFKNKQIIFDLknnKIGFIESNCP 501 Plasmodium yoelii yoelii str. 17XNL
AAW71464     488 ---NKPILGLTFFKNKQVIFDLqqnQIAFIESKCP 519 malaria parasite P. falciparum
AAS99528     436 ---NKPILGLTFFKNRQVIFDIqknRIGFVDANCP 467 malaria parasite P. vivax
XP_001441493 363 ---VRMILGQVWMRNWDIGFDKenlTLTFVRSNCS 394 Paramecium tetraurelia
XP_001447356 366 ---DRVILGQNWMRKKDILFDLdqqEISVVSANCT 397 Paramecium tetraurelia
AAW71466     495 ---NKPILGLTFFKNKQVIFDLqqnQIAFIESKCP 526 malaria parasite P. falciparum
XP_665895    535 ---SFLVLGASFFINKDVIIDVknsRASFVKSNCP 566 Cryptosporidium hominis TU502
XP_001388183 535 ---SFLVLGASFFINKDVIIDVknsRASFVKSNCP 566 Cryptosporidium parvum Iowa II

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap