Conserved Protein Domain Family
Ig_Neurocan

?
cd05902: Ig_Neurocan 
Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan
The members here are composed of the immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Statistics
?
PSSM-Id: 409483
View PSSM: cd05902
Aligned: 4 rows
Threshold Bit Score: 211.232
Threshold Setting Gi: 189520501
Created: 29-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ####                                                                            
O14594      41 KLGSGSVQAALAELVALPCLFtlqprp-----saardaPRIKWTKVrta---sgQRQDLPILVAKDNVVRVAKSWQGRVS 112  human
CAK04020     3 KVTHQQVQEPLSGSALLPCVFtlsps-------pshepPRIKWTKLwgqrgpdgLQKQQSILVAKDNIIKVKKAFQGRVT 75   zebrafish
AAI21482    40 RHQRDMVRCSLAQSVALPCLFllhpshppqqpndtsesPRIKWSRLqp----giGQKEVPVLVARDNVVKVARGYEGRVS 115  western clawed frog
XP_694002  127 RVTAPPLRRPLSSSVLLPCVFtlpaaa-----sspphgPFIHWTHGs-------GAQQRTVVSARDGVLRVHQAFAGRLR 194  zebrafish
Feature 1                                                        
O14594     113 LPSYPRRRANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVF 162  human
CAK04020    76 LPGYPGNRYNASLVLTGLRSSDSGMYRCEVVVGINDEQDTVPLQVTGVVF 125  zebrafish
AAI21482   116 LPGYPHNRYNATLVLSSARVSDSGVYRCEVIYGIDDEQDTVPLEVTGLVF 165  western clawed frog
XP_694002  195 LPGYSKNQLNASLELSRLRYNDSGTFRCHVALGENYEQDTVHLEVTGVVF 244  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap