Conserved Protein Domain Family
Ig_Versican

?
cd05901: Ig_Versican 
Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican
The members here are composed of the immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Statistics
?
PSSM-Id: 409482
View PSSM: cd05901
Aligned: 3 rows
Threshold Bit Score: 227.15
Threshold Setting Gi: 47550825
Created: 29-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ####                                                                            
P13611      26 VGKSPPVRGSLSGKVSLPCHFSTMPTLPpsyn--tsefLRIKWSKIevdkngkDLKETTVLVAQNGNIKIGQDYKGRVSV 103  human
NP_999853   31 VRSSSRVHGALAQSVVLPCRFLVLPPLPgssvithsdhLRIKWTKLq------SHGEAVAVVAQNGIVKMGQEYMGRVSV 104  zebrafish
ABN04220    26 LEKSSGVKGSLSGRVNLPCFFSTIPTLPpsyni-tnefLRIKWTKIvqsrdgkDPKETTVLVAQSGSIKIGQHYRGRVSV 104  African clawed frog
Feature 1                                                       
P13611     104 PTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVF 152  human
NP_999853  105 PSRPEDQGDASLTISRLRASDAGVYRCEVMHGIEDTQDSITLDVSGVVF 153  zebrafish
ABN04220   105 PSHPEDIGDASLTIVKLRASDAGAYRCEVLFGIEDTQDTVSLDVSGVVF 153  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap