Conserved Protein Domain Family
Ig_Aggrecan

?
cd05900: Ig_Aggrecan 
Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan
The members here are composed of the immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Statistics
?
PSSM-Id: 409481
View PSSM: cd05900
Aligned: 3 rows
Threshold Bit Score: 221.351
Threshold Setting Gi: 2506814
Created: 29-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ####                                                                            
P16112      33 IPQPSPLRVLLGTSLTIPCYFidpmhpvttapstaplaPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAI 112  human
P07898      33 IPEQSPLRVVLGSSLNIPCYFnipeeed----tnalltPRIKWSKLSNGTEIVLLVATGGKIRLNAEYREVISLPNYPAI 108  chicken
CAG01055    11 IPLERPLHPVLGSKVLVPCYFqdniakdpgaptvaplsHHIKWTFITKEKISRILVASEGKVHVETEYLDRVTMINYPLV 90   Tetraodon nigrov...
Feature 1                                                 
P16112     113 PSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVF 155  human
P07898     109 PTDATLEIKALRSNHTGIYRCEVMYGIEDRQDTIEVLVKGVVF 151  chicken
CAG01055    91 SSDASIEITELRSKDSGTYRCEVIHGIEDNYDSVTIQVQGIVF 133  Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap