5WY8


Conserved Protein Domain Family
Ig1_IL1RAPL-1_like

?
cd05896: Ig1_IL1RAPL-1_like 
First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1), and similar domains
The members here are composed of the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with interleukin-1 receptor accessory protein (IL1RAP). IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. IL1RAPL is encoded by a gene on the X-chromosome, this gene is wholly or partially deleted in multiple cases of non-syndromic intellectual disability. This group also contains IL1RAPL-2 which is also encoded by a gene on the X-chromosome and is a candidate for another non-syndromic intellectual disability loci.
Statistics
?
PSSM-Id: 409477
View PSSM: cd05896
Aligned: 5 rows
Threshold Bit Score: 214.428
Threshold Setting Gi: 117606157
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:putative antagonist binding site [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          # ######                                                                      
5WY8_B         6 TDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGp--gDFEEPIAFDGSRMSKEEDSIWFRPTL 83  human
XP_420348     21 IDWSVDLKTYMALAGEPVRVKCALFYSYIRTNYSMAQSTGLRLMWYKNKG----DLEEPIIFSEVRMSKDEDSIWFHSVD 96  chicken
NP_001072367  32 IDWSVDLKKYMGLAGEPVRVKCALFYSYIRTNYSMAQSAGLRLMWYKTKG----DLEEPIIFSVVRMSKDDDSIWIHTAE 107 western clawed ...
NP_001071044  33 TDWSVDYLKCRVLHGEPVRIKCALFYGYIRANYTQAQSIGLSLMWYRSSGlghgDFEEPISFDGTRMSKEEDAIWFRPAE 112 zebrafish
AAF59411      32 TDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGp--gDFEEPIAFDGSRMSKEEDSIWFRPTL 109 human
Feature 1                                   
5WY8_B        84 LQDSGLYACVIRNSTYCMKVSISLTVG 110 human
XP_420348     97 LQDSGFYTCVLRNSTYCMKVSMSLTVA 123 chicken
NP_001072367 108 VQDGGLYTCVLRNATYCMKVSMSLTVA 134 western clawed frog
NP_001071044 113 LQDAGLYSCVLRNSTFCMKVSMTLLVA 139 zebrafish
AAF59411     110 LQDSGLYACVIRNSTYCMKVSISLTVG 136 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap