1GXE


Conserved Protein Domain Family
Ig_C5_MyBP-C

?
cd05894: Ig_C5_MyBP-C 
C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C)
The members here are composed of the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP-C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP-C exist: slow-skeletal (ssMyBP-C), fast-skeletal (fsMyBP-C), and cardiac (cMyBP-C). cMYBP-C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Statistics
?
PSSM-Id: 409475
View PSSM: cd05894
Aligned: 5 rows
Threshold Bit Score: 128.804
Threshold Setting Gi: 1372103417
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            #####                                                                        
1GXE_A         24 IPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAiTQGnkaparpapdapedtgdsdewvfdkkllcetegrVRVETTKDRS 103  human
AAA49068      402 AENTIVVVAGNKVRLDVPISGEPAPTVTWKRG-DQLftat---------------------------egrVHIDSQADLS 453  chicken
NP_001013529  515 SQNTIIVVAGNKLRLDVEITGEPAPTVCWMRD-DKPvtds---------------------------egrVRVENKKDLS 566  zebrafish
Q14324        551 SENAIVVVAGNKLRLDVSITGEPPPVATWLKG-DEVfttt---------------------------egrTRIEKRVDCS 602  human
Q00872        531 ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG-DKAimeg---------------------------sgrIRTESYPDSS 582  human
Feature 1                                           
1GXE_A        104 IFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 137  human
AAA49068      454 SFVIESAERSDEGRYCITVTNPVGEDSATLHVRV 487  chicken
NP_001013529  567 CFIIEGAEREDEGNYTITVTNPAGEDKANLFIKI 600  zebrafish
Q14324        603 SFVIESAQREDEGRYTIKVTNPVGEDVASIFLQV 636  human
Q00872        583 TLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap