2DM2,2LQR


Conserved Protein Domain Family
IgI_1_Palladin_C

?
cd05893: IgI_1_Palladin_C 
First C-terminal immunoglobulin (Ig)-like domain of palladin; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (also known as DIP or mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409474
View PSSM: cd05893
Aligned: 5 rows
Threshold Bit Score: 201.479
Threshold Setting Gi: 159164210
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ####                                                                            
2DM2_A       9 PFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANP 88   human
2LQR_A       8 PFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANP 87   house mouse
PNI61842    70 PFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTVQRDLDGTCSLHTTASTLDDDGNYTIMAANP 149  Pan troglodytes
ERE92365   145 PFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTMASTLDDDGNYTIMAANP 224  Cricetulus griseus
Q8WX93    1001 PFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANP 1080 human
Feature 1                  
2DM2_A      89 QGRISCTGRLMV 100  human
2LQR_A      88 QGRVSCTGRLMV 99   house mouse
PNI61842   150 QGRISCTGRLMV 161  Pan troglodytes
ERE92365   225 QGRVSCTGRLMV 236  Cricetulus griseus
Q8WX93    1081 QGRISCTGRLMV 1092 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap