2KKQ


Conserved Protein Domain Family
IgI_Myotilin_C

?
cd05892: IgI_Myotilin_C 
C-terminal immunoglobulin (Ig)-like domain of myotilin; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating the actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin, and actin. Mutations in myotilin lead to muscle disorders. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409473
View PSSM: cd05892
Aligned: 9 rows
Threshold Bit Score: 176.113
Threshold Setting Gi: 47214118
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ####                                                                            
2KKQ_A         16 PMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNE 95   human
XP_001375910  644 PMFIYKPQSKKVYEGDSVKLECQVSAIPPPKIFWKRNNEMVQFNTDRISLYHDNSGRITLLIKDANKKDAGWYTVSAVNE 723  gray short-ta...
NP_001017159  224 PCFIQKPAAIKAIEGENIKIECLISAIPQPQILLKKNNEMLRYNTDRIRLYQDDSGRVSLVIYNVNKTDDGWYTISAVNE 303  western clawe...
XP_414618     357 PTFIFKPQSKKVFEGDTARLECQISAIPTPRIYWKRNNEMVQYNTDRISLLHDNTGRICLLIHNANKKDAGWYTVSAVNG 436  chicken
NP_006781     349 PMFIYKPQSKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNE 428  human
CAG10993      581 ARVHGETAEHQLAEGHPVRLECRVSGVPHPQIFWKRENESLTQNTERISMHQDNCGYLCMIIQPALKEDAGWYTVSAKNE 660  Tetraodon nig...
XP_420396    1051 PVFIEKLQNTGVTEGFPVRLECRISGEPSPQIFWKKENESITHNTDRVSMHQDNYGYICLLIQGATKEDAGWYTVSAKNE 1130 chicken
NP_057165    1010 PVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNE 1089 human
CAG00683      212 PIFVQRLLNSRALEGDTVSLECKVDASPTPQVFWKKDKEMLRIDPSRMSLYQDGCGRHRLLIEWVTKSDAGWYTVSAINV 291  Tetraodon nig...
Feature 1                     
2KKQ_A         96 AGVTTCNTRLDV 107  human
XP_001375910  724 AGVVTCNTRLDV 735  gray short-tailed opossum
NP_001017159  304 AGVATCHARLDV 315  western clawed frog
XP_414618     437 AGVATCHARLEV 448  chicken
NP_006781     429 AGVTTCNTRLDV 440  human
CAG10993      661 AGIVSSTARLDV 672  Tetraodon nigroviridis
XP_420396    1131 AGIVSCTARLDV 1142 chicken
NP_057165    1090 AGIVSCTARLDV 1101 human
CAG00683      292 AGMSSCNARLDV 303  Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap