Conserved Protein Domain Family
IgI_M-protein_C

?
cd05891: IgI_M-protein_C 
C-terminal immunoglobulin (Ig)-like domain of M-protein; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Statistics
?
PSSM-Id: 143299
View PSSM: cd05891
Aligned: 4 rows
Threshold Bit Score: 183.572
Threshold Setting Gi: 189538569
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ####                                                                            
P54296    1344 GRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNK 1423 human
AAH52969  1344 GRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLSEHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNK 1423 human
XP_684794  447 GKVVGGLPDVVTIMEKKTLSLTCTVCGDPKPQVSWSKNDQEVEPSDQYVIALDSGKFASLTIKGVSMEDSGKYTMTVQNR 526  zebrafish
Q02173    1332 GKVIGGLPDVVTIMDGKTLNLTCTVFGNPDPEVVWFKNDKALELNEHYLVSLEQGKYASLTIKGVTSEDSGKYSIYVKNK 1411 chicken
Feature 1                  
P54296    1424 YGGEKIDVTVSV 1435 human
AAH52969  1424 YGGEKIDVTVSV 1435 human
XP_684794  527 FGGETVDIIVSV 538  zebrafish
Q02173    1412 YGGETVDVTVSV 1423 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap