6O3O,6O3O


Conserved Protein Domain Family
IgV_1_DNAM-1_like

?
cd05889: IgV_1_DNAM-1_like 
First immunoglobulin variable (IgV) domain of DNAX accessory molecule 1, and similar domains
The members here are composed of the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Statistics
?
PSSM-Id: 409472
View PSSM: cd05889
Aligned: 6 rows
Threshold Bit Score: 187.377
Threshold Setting Gi: 123707596
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 61 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Comment:Based on similarity to human poliovirus receptor (CD155).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      ########      #########      #############                   #####
6O3O_A         1 TGEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIgt-qQDSIAIFSPTHGMVIRKPYAERVYFLNStmasnNMTLFF 79  human
6O3O_B         1 TGEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIgt-qQDSIAIFSPTHGMVIRKPYAERVYFLNStmasnNMTLFF 79  human
Q15762        17 LCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIgt-qQDSIAIFSPTHGMVIRKPYAERVYFLNStmasnNMTLFF 95  human
XP_001235285  19 NVEGRFVDSTIKLSEKMKLECMYPKKAVIIQTSWMKHngshKENVAVLHPIYGIHIEDKYRGRIYFENTsr--eDQSLSF 96  chicken
NP_001074115  24 SVQMKAPESSVVLQEGMVLDCLCPWTGQLIMVSWTKTp--fAKPIAVYHPQYGTNFGSSYEGRVEFLKSta--mDGSISI 99  zebrafish
EDL75159      17 LCEETLWDTTVRLSETMTLECVYPLTDNLTQAEWTKDtgtkKVNIAVYHPNHNMHIDPNYLHRVHFQNAtvgfrNMSLSF 96  Norway rat
Feature 1        ##    ###############  #########
6O3O_A        80 RNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS 111 human
6O3O_B        80 RNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS 111 human
Q15762        96 RNASEDDVGYYSCSLYTYPQGTWQKVIQVVQS 127 human
XP_001235285  97 NKSTLEDVGLYCCSIVTYPDGVSEKVIEVIHP 128 chicken
NP_001074115 100 MNVTEGDIGQYHCSLQTYPQGSWTKDTFVQKA 131 zebrafish
EDL75159      97 YNASEADIGIYTCLFHAFPRGSWEKKIKVVQS 128 Norway rat

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap