4FOM


Conserved Protein Domain Family
IgV_1_Nectin-3_like

?
cd05887: IgV_1_Nectin-3_like 
First immunoglobulin variable (IgV) domain of nectin-3 (also known as poliovirus receptor related protein 3), and similar domains
The members here are composed of the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3 (PVRL3) or cluster of differentiation (CD) 113). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls); nectin-3 for example, trans-interacts with Necl-5, regulating cell movement and proliferation. Other proteins with which nectin-3 interacts include the actin filament-binding protein, afadin, integrin alpha-beta3, Par-3, and PDGF receptor; its interaction with PDGF receptor regulates the latter's signaling for anti-apoptosis.
Statistics
?
PSSM-Id: 409470
View PSSM: cd05887
Aligned: 5 rows
Threshold Bit Score: 212.103
Threshold Setting Gi: 134054448
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 61 residues -Click on image for an interactive view with Cn3D
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Comment:Based on similarity to human poliovirus receptor (CD155).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   ########        #########      #############                 #####
4FOM_A      1 GPIIVEPHVTAVWGKNVSLKCLIEVne--tITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITL 78  human
XP_416630  64 AGPVVDPHVTAVWGKKVALKCIIDVne--tITQVSWEKIHGKTSETIAVHHPEYGISIQEKYQGKVSFKNYSLTDATIIL 141 chicken
CAM73218   37 SQVIVPPKVNAVLGKNVTLSCRVQVdtnlsLTQSSWERKLPNGWVTLAVYNPMFGISIPPDYERRLSFRSPSALDATIML 116 zebrafish
AAH67808   58 GPIIVEPHVTAVWGKNVSLKCLIEVne--tITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITL 135 human
Q9NQS3     58 GPIIVEPHVTAVWGKNVSLKCLIEVne--tITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITL 135 human
Feature 1     ##    ###############  #########
4FOM_A     79 HNIGFSDSGKYICKAVTFPLGNAQSSTTVTVL 110 human
XP_416630 142 KNVSFSDAGEYICKAVTFPLGNSQSSITVTVL 173 chicken
CAM73218  117 EDVGFADIGVYTCKVATFPLGNTQASTTVSVL 148 zebrafish
AAH67808  136 HNIGFSDSGKYICKAVTFPLGNAQSSTTVTVL 167 human
Q9NQS3    136 HNIGFSDSGKYICKAVTFPLGNAQSSTTVTVL 167 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap