5ZO2,5ZO2


Conserved Protein Domain Family
IgI_2_Necl-4

?
cd05885: IgI_2_Necl-4 
Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4); member of the I-set of Ig superfamily domains
The members here are composed of the second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4; also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination. In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated. Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Statistics
?
PSSM-Id: 409468
View PSSM: cd05885
Aligned: 5 rows
Threshold Bit Score: 175.531
Threshold Setting Gi: 55925349
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ####                                                                            
5ZO2_A        97 LVAPENPVVEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKDDGGIVICE 176 house mouse
5ZO2_C        97 LVAPENPVVEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKDDGGIVICE 176 house mouse
NP_001007429 123 VVPPEVPSVEVKTEAVEGGEVELTCLSLRSKLPATLRWVRDRREIPGVISQQENGKTVSVSNTIRIPVERKDNGAALSCE 202 zebrafish
Q8NFZ8       121 LVAPENPVVEVREQAVEGGEVELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICE 200 human
NP_001087300 124 IVPPDNPLVEVKEQAVEGGEIELTCISPRTKPAATLRWYRDRKELKGFTSKQENGKTFSITNSIRFNVDRKDDGNIVTCE 203 African clawed ...
Feature 1                            
5ZO2_A       177 AQNQALpsghsKQTQYVLDV 196 house mouse
5ZO2_C       177 AQNQALpsghsKQTQYVLDV 196 house mouse
NP_001007429 203 ASHPALvs-qkRVRHYSLDV 221 zebrafish
Q8NFZ8       201 AQNQALpsghsKQTQYVLDV 220 human
NP_001087300 204 ASHPALkg-qkKQTQYELDV 222 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap