Conserved Protein Domain Family
IgI_2_Necl-2

?
cd05883: IgI_2_Necl-2 
Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (Necl-2); member of the I-set of Ig superfamily domains
The members here are composed of the second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (Necl-2; also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 through Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues and is a putative tumour suppressor gene which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Statistics
?
PSSM-Id: 409466
View PSSM: cd05883
Aligned: 4 rows
Threshold Bit Score: 183.583
Threshold Setting Gi: 47227747
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ####                                                                            
NP_001091987 141 LVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELK-GKSEVEEW-SDMYTVTSQLMLKVHKEDDGVPV 218 human
XP_417901    127 LVPPRNLVIDIQKEIAVEGEEIELNCTAMASRPATTIRWFKGNKELT-GKSEVEQW-SDMYTVTSQLLLKVGREDDGVPV 204 chicken
NP_001090152 125 LVPPHNLVIDVQKDTYVEGDEVEMNCTALASKPAATIRWFKGNKELTaVKTDVEPMeERMFRVRSQLMLTAKREDDGIPI 204 African clawed ...
CAG08910      99 LVPPGSPIIESRDDMVNEGNETELTCTAIGSKPAASIRWMKGEEELT-GEATVEETyDRMFTVTSRVRFSVTKDDDGVPV 177 Tetraodon nigro...
Feature 1                             
NP_001091987 219 ICQVEHPAVTgnLQTQRYLEV 239 human
XP_417901    205 ICLVDHPAVKd-LQTQRYLEV 224 chicken
NP_001090152 205 VCLVDHPAVKd-LQTQQYLEV 224 African clawed frog
CAG08910     178 DCIIDHPAAKd-LLAQRHLEV 197 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap