1Z9M


Conserved Protein Domain Family
IgV_1_Necl-1

?
cd05882: IgV_1_Necl-1 
Click on image for an interactive view with Cn3D
First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-1 (Necl-1); member of the V-set of Ig superfamily (IgSF) domains
The members here are composed of the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, or IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myelinated axons.
Statistics
?
PSSM-Id: 143290
View PSSM: cd05882
Aligned: 3 rows
Threshold Bit Score: 197.963
Threshold Setting Gi: 90108609
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:
  • Structure:1Z9M, human CADM3 (Necl-1) N-terminal IgV domain dimer interface, contacts based on 3.5 A distance.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  #  #    ## #     # #                                  
1Z9M_A        42 QPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCS 121 human
NP_001038711  43 QPVTQDETVAVGGVVTLTCGVKENDNSSLQWSNTAQQTLYFGEKRALRDNRIQLVKSTATELIITIGDVQLSDDGEYTCS 122 zebrafish
NP_001080468  27 QPVTADVIVPTGGTAILKCTVQEHLESSLQWSNTAQQTLYFGEKRALRDNRIQLVHSSPNELTISISNVVLSDEGEYTCS 106 African clawed ...
Feature 1         #             
1Z9M_A       122 IFTMPVRTAKSLVTV 136 human
NP_001038711 123 IFTMPVRTARATVTV 137 zebrafish
NP_001080468 107 IFTMPVRTAKAVVTV 121 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap