4H5S


Conserved Protein Domain Family
IgV_1_Necl-2

?
cd05881: IgV_1_Necl-2 
First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2; member of the V-set of Ig superfamily (IgSF) domains
The members here are composed of the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma.
Statistics
?
PSSM-Id: 409465
View PSSM: cd05881
Aligned: 5 rows
Threshold Bit Score: 179.812
Threshold Setting Gi: 529281086
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:putative dimer interface [polypeptide binding site]
Evidence:
  • Comment:Based on similarity to human CADM3 (Necl-1).

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                 #  #    ## #     # #                                   
4H5S_B         4 LFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQL 83  human
AAI25104      47 LFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQL 126 human
NP_001090152  31 LVTEDVTVVEGEVAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPLKDSRFQLVNFSSNELRVSLSNVTLEDEGRYLCQL 110 African clawed ...
XP_417901     33 LITEDVTVVEGDVATISCRVKNSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLVNFSNSELRVSLTNVSISDEGRYFCQL 112 chicken
ABW73821      47 LVTNNVSVVEGETAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPLKDSRFQLVNFSDNELLVSLSNVSLSDEGRYVCQL 126 zebrafish
Feature 1        #             
4H5S_B        84 YTDPPQESYTTITV 97  human
AAI25104     127 YTDPPQESYTTITV 140 human
NP_001090152 111 YTDPPQEAFTTITV 124 African clawed frog
XP_417901    113 YTDPPQEIYTTITV 126 chicken
ABW73821     127 YTDPPQEAYADITV 140 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap