Conserved Protein Domain Family
IgV_EVA1

?
cd05880: IgV_EVA1 
Immunoglobulin (Ig)-like domain of epithelial V-like antigen (EVA) 1
The members here are composed of the immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA 1). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule and may play a role in the structural organization of the thymus and early lymphocyte development.
Statistics
?
PSSM-Id: 409464
View PSSM: cd05880
Aligned: 4 rows
Threshold Bit Score: 212.765
Threshold Setting Gi: 118101995
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        #####                                                                           
O60487        27 VEIYTSRVLEAVNGTDARLKCTFSSfapv-gdaLTVTWNFRPLDGGPEQFVFYYHIDPFQPmsgrFKDRVSWDGNPERYD 105 human
XP_001233848  26 IEVYTSKEVYAVNGTSLRLKCTFSSsspi-splLSVTWNFQPEDLSSHEPVFYYLKEPYTPsagrFKGRITWDGHIERHD 104 chicken
NP_001086870  26 IEVFTNKELEAVNGTDTRLKCTFSSsapv-gdnIIIVWLFRPLSGGEDQTIFYYHKNAYPQldgrFQGRAVWDGNIMRND 104 African clawed ...
CAF95559       4 MHVYTPGDVEAVNGTDVRLKCTFYSsapinpntVVISWSFRPLKPGREESVFHYQQRPYPPpdgiFRKRVVWAGDVMGRD 83  Tetraodon nigro...
Feature 1                                             
O60487       106 ASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSV 142 human
XP_001233848 105 VSIVIWDLQPTDNGTFTCQVKNPRDIDGTIGEVRLRV 141 chicken
NP_001086870 105 ASILIRNIQPMDNGTYLCQVKNPPDVHVEMGEIQVRV 141 African clawed frog
CAF95559      84 ASIILQQVKFTYNGTYVCQVKNPPDVHGPSGEIRLRV 120 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap