1NEU


Conserved Protein Domain Family
IgV_P0

?
cd05879: IgV_P0 
Click on image for an interactive view with Cn3D
Immunoglobulin (Ig)-like domain of protein zero (P0)
The members here are composed of the immunoglobulin (Ig) domain of protein zero (P0), a myelin membrane adhesion molecule. P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Statistics
?
PSSM-Id: 409463
View PSSM: cd05879
Aligned: 4 rows
Threshold Bit Score: 230.919
Threshold Setting Gi: 157832102
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:tetramer interface [polypeptide binding site]
Evidence:
  • Comment:Tetrameric association of P0ex domains inferred from crystal contacts and supported by analytical ultracentrifugation.
  • Citation:PMID 8816707
  • Comment:P0ex tetramer is comprised of four molecules arranged around a central hole.
  • Comment:P0ex domains, may come from one membrane surface as tetramers, that link to POex tetramers from the opposing membrane surface.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         # #           #       # #                                         #  #         
1NEU_A         1 IVVYTDREVYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDevgtFKERIQWVGDPSWKD 80  Norway rat
P37301        30 IHVYTPREVYGTVGSHVTLSCSFWSSEWISEDISYTWHFQAEGSRDSISIFHYGKGQPYIDdvgsFKERMEWVGNPRRKD 109 chicken
NP_001091356  29 IEVYTDREVYGTAGSRVTLSCSFWSSEWISDDISVTWHYQPDHSREMYSIVHFAKGLSSIDag-iFKDRIEWVGSPKWKD 107 African clawed ...
NP_919342     22 LVVNTDSEKHALVGSDVRLSCSFFSWQWTSPEVSFTWHYRPDGAKDAISIFHYGGGEAYPAnkgpFQNRLEFVGNPSRRD 101 zebrafish
Feature 1             ##                              
1NEU_A        81 GSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYV 117 Norway rat
P37301       110 GSIVIHNLDYTDNGTFTCDVKNPPDIVGKSSQVTLYV 146 chicken
NP_001091356 108 ASIVVHNLELTDNGTFTCDVKNPPDVVGKSSYVHLQV 144 African clawed frog
NP_919342    102 GSILIKNLDFGDNGTFTCDAKNPPDIGGHPSTIRLLV 138 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap