Conserved Protein Domain Family
Ig_LP_like

?
cd05877: Ig_LP_like 
Immunoglobulin (Ig)-like domain of human cartilage link protein (LP), and similar domains
The members here are composed of the immunoglobulin (Ig)-like domain similar to that found in human cartilage link protein (LP; also called hyaluronan and proteoglycan link protein). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Statistics
?
PSSM-Id: 409461
View PSSM: cd05877
Aligned: 12 rows
Threshold Bit Score: 165.576
Threshold Setting Gi: 47214540
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1        ####                                                                            
P10915        43 EAEQAKVFSHRGGNVTLPCKFyrdptaf-gsgihkIRIKWTKLts-dYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS 120 human
CAG05375      10 AAEQTKVVSRRGGNATLPCKIqrdqsl---apnrkMRIKWTKLts-dYLKEVDVFVAMDYHKRSYGSFHGRVHLQGSSPM 85  Tetraodon nigro...
NP_998266     54 ESPETLVSAVQGSNVTLPCHYryepal---saprrTRVKWFWQpvngEGQEHDVMVAIGTRHRSYGDFKGRVRLRRSTPG 130 zebrafish
NP_990813     43 VAEQAKIFSQRGGNVTLPCKFyhehtstagsgthkIRVKWTKLts-dYLKEVDVFVAMGHHRKSYGKYQGRVFLRESSEN 121 chicken
NP_001038372  14 QTAPGKVVTHRGGTITLPCRYhheped---idpnrIRIKWTKVs--dAFQFEDVFVALGRQQKAFGSYQERVSLEQAGPG 88  zebrafish
AAH78043      87 NTPDDPLFGYRGGNATLPCTFhyepkl---nstrkYRVKWSKLhk-dNTKERDVLVAIGLRHRSFGEYKGRVHLIQKMPN 162 African clawed ...
CAM60103      37 PLVFAEVSARRGHAAILPCVMrfk--------pshYRVKWTKLepssRGVENIVLITNGHADKQYGSVGPRAALQRAHDL 108 zebrafish
CAG04560      69 PPVYAEVVAARGEDVALPCILrtk--------psqYKVKWSKVevetVEREKVIIISSGDAYKTYGHLGRRASLRRAHVL 140 Tetraodon nigro...
CAG07892     581 EENCFRIFSEPGGNATLPCRLlskr------hnpgVQVRWTKLen-dEAPLEDVLLWLGTRSKTFGRFENRVFLQAADDR 653 Tetraodon nigro...
AAI42598      23 SKSRVKVYANRGDNITLPCRLdgqs------tlfgNRIKWTKIe--dDSTETDVLISMGFHKKAYGSYQDRAYLLEVDDS 94  zebrafish
Q80WM5        52 ETTEESLFSHQGASVTLPCHYhyepal---asprhVRVKWWKLse-nGAPEQDVLVVIGQRHRSFGDYQGRVQLRQDKQQ 127 house mouse
XP_413868     53 ETSKDPIYSFSGVNVTLPCHYhhepes---eakhkIRIKWSKLrd-dYTKEQDVLVAIGKTYMAFGDFQGRAHLHRAGQR 128 chicken
Feature 1                                                 
P10915       121 DASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVF 161 human
CAG05375      86 DASLVITEITLEDYGRYKCEVIDGLEDGTAVVTLDLEGIVF 126 Tetraodon nigroviridis
NP_998266    131 DASLVINPLQSDDTGRYRCEIIDGLEDESVTMQLKFRGVVF 171 zebrafish
NP_990813    122 DASLIITNIMLEDYGRYKCEVIEGLEDDTAVVALNLEGVVF 162 chicken
NP_001038372  89 DASVIIHNITLEDYGRYECEVTNDMEDDTGFVNLDLEGVVF 129 zebrafish
AAH78043     163 EVSLVITDLRLEDYGNYKCEVIDGLEDESGIVELELRGVVF 203 African clawed frog
CAM60103     109 DVSLRLSDLELEDDGSYRCELINGIEDESVIITLRIEGVVF 149 zebrafish
CAG04560     141 DASLQLSRLELEDGGRYRCQLIHDLHDESVLVALRIRGISQ 181 Tetraodon nigroviridis
CAG07892     654 DASLVITDIATEDIGQYRCEVSDGMKHTAEEGFLKVQGCVT 694 Tetraodon nigroviridis
AAI42598      95 DATLVITDLDVNDYGTYRCEFIDGMNDMTLEVDLEVQGVVF 135 zebrafish
Q80WM5       128 EVSLELRDLRLEDSGRYRCEVIDGLEDESGLVELELRGVVF 168 house mouse
XP_413868    129 EASLLISDVRLQDDGKYRCEVIDGLEDASDVVELRLRGGGW 169 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap