Conserved Protein Domain Family
IgI_NrCAM

?
cd05874: IgI_NrCAM 
Immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule); member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the first immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Statistics
?
PSSM-Id: 409458
View PSSM: cd05874
Aligned: 4 rows
Threshold Bit Score: 207.144
Threshold Setting Gi: 33416335
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         #####                                                                           
P35331         41 PTITQQSPKDYIVDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDAQVTMKPNSGTLVVNIMNGVKAEAYEGVYQCTA 120  chicken
CAA04507       41 PTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTA 120  human
AAH55495       33 PTITHQSPKDYIVDPRENIVIYCEAKGKPHPSFSWTRNGTHFDIEKDPKVIMKPHTGTLVIDISGGEKTEAYEGVYQCAA 112  zebrafish
NP_001085487   35 PTITHQSPKNYIVDPRESIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPYVTMKPNSGTLVINTMNGARVDAYEGEYQCTA 114  African clawe...
Feature 1                        
P35331        121 RNERGAAISNNIVIR 135  chicken
CAA04507      121 RNERGAAVSNNIVVR 135  human
AAH55495      113 HNQLGTAVSSHIHIR 127  zebrafish
NP_001085487  115 RNDRGSALSNNIVIR 129  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap