2VA4


Conserved Protein Domain Family
IgI_NCAM-2

?
cd05870: IgI_NCAM-2 
Click on image for an interactive view with Cn3D
Immunoglobulin (Ig)-like I-set domain of Neural Cell Adhesion Molecule 2 (NCAM-2)
The members here are composed of the fourth Ig domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2 is organized similarly to NCAM, including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule. One of the unique features of I-set domains is the lack of a C" strand. The structures of this group show that the Ig domain lacks this strand and thus is a member of the I-set of Ig domains.
Statistics
?
PSSM-Id: 143278
View PSSM: cd05870
Aligned: 3 rows
Threshold Bit Score: 204.826
Threshold Setting Gi: 134085234
Created: 29-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1     ######                                                                          
2VA4_A     94 VQPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQHGSSSLHIKDVKLSDSGRYD 173 human
CAM60097  298 VQPHITKLRNVTAVEGSAAMISCKAEGEPLPEISWRRASDGHSFSDGDKSPDGRVEVRGRYGESMLTIVVVKLSDWGRFD 377 zebrafish
XP_425540 315 VQPQIIQLKNETTFENGKATLICEAEGEPIPEITWKRATDGITFSEGDKSPDGRIEVKGQHGKSSLHIKDVKLSDSGRYD 394 chicken
Feature 1                       
2VA4_A    174 CEAASRIGGHQKSMYLDI 191 human
CAM60097  378 CEALSRIGGHQKSMFLDI 395 zebrafish
XP_425540 395 CEAASRIGGHQKSMYLDI 412 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap