Conserved Protein Domain Family
Ig4_NrCAM

?
cd05868: Ig4_NrCAM 
Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule)
The members here are composed of the fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Statistics
?
PSSM-Id: 409454
View PSSM: cd05868
Aligned: 3 rows
Threshold Bit Score: 196.741
Threshold Setting Gi: 49117906
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
 
Feature 1:Ig strand B [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #####                                                           
462740     338 YWITAPRNLVLSPGEDGTLICRANGNPKPSISWLTNGVPIAIAPEDPSRKVDGDTIIFSAVQERSSAVYQCNASNEYGYL 417  chicken
AAH72835   351 YWISPPTNIVLSPGEDGSLICRASGNPTPSITWLINGVSIELAPTDASRRVDGDTIIFSKVQDGATAVYQCNVSNKYGYL 430  African clawed frog
Q92823     362 YWITAPQNLVLSPGEDGTLICRANGNPKPRISWLTNGVPIEIAPDDPSRKIDGDTIIFSNVQERSSAVYQCNASNEYGYL 441  human
Feature 1               
462740     418 LANAFVNVL 426  chicken
AAH72835   431 LANAFVNVL 439  African clawed frog
Q92823     442 LANAFVNVL 450  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap