2V44


Conserved Protein Domain Family
IgI_1_NCAM-2

?
cd05866: IgI_1_NCAM-2 
Click on image for an interactive view with Cn3D
First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2 is organized similarly to NCAM-1, including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409452
View PSSM: cd05866
Aligned: 4 rows
Threshold Bit Score: 194.884
Threshold Setting Gi: 194709025
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 3 residues -Click on image for an interactive view with Cn3D
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    # ##                                                             
2V44_A      3 LQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKG 82  human
XP_425540  36 LQVSISLSKVELSVGESKFFTCTAIGEPDNIDWYNPQGEKIVSSQRVVVQKEGVRSRLIIYNADIEDAGIYRCQATDAKG 115 chicken
O15394     21 LQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKG 100 human
CAM60097   20 LQVSISLKKVELSVGESKFFTCTVIGEPVKLEWFNPQGERMVASPRVALHNEGIRSRLTLYNAKIEDAGIYRCQATDAQG 99  zebrafish
Feature 1                  
2V44_A     83 QTQEATVVLEIYQ 95  human
XP_425540 116 QTQEATVVLEIYQ 128 chicken
O15394    101 QTQEATVVLEIYQ 113 human
CAM60097  100 ETQEATVVLEIYQ 112 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap