1EV2


Conserved Protein Domain Family
IgI_3_FGFR2

?
cd05858: IgI_3_FGFR2 
Click on image for an interactive view with Cn3D
Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2); member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409444
View PSSM: cd05858
Aligned: 4 rows
Threshold Bit Score: 229.462
Threshold Setting Gi: 120048
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 9 residues -Click on image for an interactive view with Cn3D
Feature 1:polypeptide ligand binding site [polypeptide binding site]
Evidence:
  • Structure:1EV2; Fiboblast Growth Factor 2 (FGF2) complexed with the Ig-like domains D2 and D3 of FGF receptor 2 (FGFR2), contacts based on 3.5 A distance.
    View structure with Cn3D
  • Comment:The Ig-like domains D2 and D3 and the loop that connects them define the general binding site.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                             #    ###                            ##   #   #          
1EV2_E    110 PILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFE 189 human
116097    247 PILQAGLPANQTVVVGSNVEFHCKVYSDAQPHIQWLKHVEVNGSKYGPDGTPYVTVLKTAGVNTTDKELEILYLRNVTFE 326 chicken
Q8JG38    256 PILQAGLPANVTVQVGQDAKFVCKVYSDAQPHIQWLQHYTKNGSCCGPDGLPYVRVLKTAGVNTTDKEIEVLYLPNVTFE 335 zebrafish
P22182    251 PILQAGLPANTSVTVGTTAEFSCKVYSDPQPHIQWLRHIEINGSRVASDGFPYVEILKTAGVNTSDKDMEVLHLRNVTFE 330 African clawed frog
Feature 1               #              
1EV2_E    190 DAGEYTCLAGNSIGISFHSAWLTVL 214 human
116097    327 DAGEYTCLAGNSIGFSHHSAWLTVL 351 chicken
Q8JG38    336 DAGEYTCLAGNSIGISYHTAWLTVH 360 zebrafish
P22182    331 DAGQYTCLAANSIGISHHSAWLTVL 355 African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap