Conserved Protein Domain Family
Ig6_Contactin-2

?
cd05854: Ig6_Contactin-2 
Sixth immunoglobulin (Ig) domain of contactin-2
The members here are composed of the sixth immunoglobulin (Ig) domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells (AC) in the developing chick retina, corresponding to the period of formation and maturation of AC processes.
Statistics
?
PSSM-Id: 409440
View PSSM: cd05854
Aligned: 3 rows
Threshold Bit Score: 217.602
Threshold Setting Gi: 114735
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      #######                                                                         
NP_571521  508 DATKITLAPSNADINQGENATLQCHASHDPTMDLTFTWSLNGVPLDLEEPNGHYRRMEGKETIGDLVIVNGQLSHAGTYT 587  zebrafish
P28685     502 DATKITLAPSSADINVGENLTLQCHASHDPTMDLTFTWSLDDFPIDLDKSEGHYRRASVKEAVGDLAIVNAQLKHSGRYT 581  chicken
AAI29987   507 DATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYT 586  human
Feature 1                            
NP_571521  588 CTAQTVVDSAMASAKLVVRGPP 609  zebrafish
P28685     582 CTAQTVVDSTSESATLTVRGPP 603  chicken
AAI29987   587 CMAQTVVDSASKEATVLVRGPP 608  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap