Conserved Protein Domain Family
Ig6_Contactin-4

?
cd05853: Ig6_Contactin-4 
Sixth immunoglobulin (Ig) domain of contactin-4
The members here are composed of the sixth immunoglobulin (Ig) domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expression of contactin-4 is in testes, thyroid, small intestine, uterus, and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Statistics
?
PSSM-Id: 409439
View PSSM: cd05853
Aligned: 3 rows
Threshold Bit Score: 224.119
Threshold Setting Gi: 47940323
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      #######                                                                         
XP_414435  498 DPTRVMVSPFSMDVTVGESIVLPCQVSHDHSLDIVFTWSFNGHLIDFEKDGDHFERVGGQDSAGDLMIRSIQLKHAGKYV 577  chicken
AAH72368   497 DPTQVLVPPSSMDVTVGESIVLPCQVSHDHSLDISFSWVFNGQLIDFQKDGEHFERVGGQDSAGDLMIRSIQLKHAGKYI 576  African clawed frog
EAW63876   496 DPTRVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLIDFDRDGDHFERVGGQDSAGDLMIRNIQLKHAGKYV 575  human
Feature 1                            
XP_414435  578 CMVQTSVDKLSAAADLIVRGPP 599  chicken
AAH72368   577 CLVHTSVDKLSAGADLIVRGPP 598  African clawed frog
EAW63876   576 CMVQTSVDRLSAAADLIVRGPP 597  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap