Conserved Protein Domain Family
Ig5_Contactin-1

?
cd05852: Ig5_Contactin-1 
Fifth immunoglobulin (Ig) domain of contactin-1
The members here are composed of the fifth immunoglobulin (Ig) domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Statistics
?
PSSM-Id: 409438
View PSSM: cd05852
Aligned: 3 rows
Threshold Bit Score: 189.054
Threshold Setting Gi: 3219157
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ######                                                                          
P14781     404 PTFELNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTELLVNGSRIHIWDDGSLEIINVTKLDEGRYTCFAENNRGK 483  chicken
Q12860     413 PTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGK 492  human
BAA28780   399 PTFEFTPMRKKVLAAKGGRVIIECKPKAAPKAKFSWSKGTELLINNSRVSIWDDGSLEILNITKLDEGSYTCYAENDRGK 478  Xenopus laevis l...
Feature 1               
P14781     484 ANSTGVLEM 492  chicken
Q12860     493 ANSTGTLVI 501  human
BAA28780   479 ANGTAVLSV 487  Xenopus laevis laevis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap