1CS6,2OM5


Conserved Protein Domain Family
IgI_1_Contactin-2

?
cd05850: IgI_1_Contactin-2 
Click on image for an interactive view with Cn3D
First immunoglobulin (Ig) domain of contactin-2; member of the I-set of Ig superfamily domains
The members here are composed of the first immunoglobulin (Ig) domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing chick retina, corresponding to the period of formation and maturation of AC processes. This group belongs to the I-set of IgSF domains.
Statistics
?
PSSM-Id: 409437
View PSSM: cd05850
Aligned: 4 rows
Threshold Bit Score: 193.988
Threshold Setting Gi: 18858449
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:interdomain interface [polypeptide binding site]
Evidence:
  • Structure:1CS6; Gallus gallus axonin-1 Ig1/Ig4 interdomain interface, contacts based on 3.5 A distance.
    View structure with Cn3D
  • Comment:Chicken axonin-1 domains Ig1 and Ig4 interact with each other, helping to form the U shaped structure of the intermolecular binding fragment.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1       ##                                                                             
1CS6_A       3 YGPVFEEQPAHTLFPEGSAEEKVTLTCRARANPPATYRWKMNGTELKMGPDSRYRLVAGDLVISNPVKAKDAGSYQCVAT 82   chicken
2OM5_A       2 FGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLAS 81   human
NP_571521   32 SGPVFEEQPSSLIYPEGMPEGKVTLGCQARSSPAAVYRWRVNGTDISFAEESHYTQVAGNLVINNPQNGRDGGSYQCLAI 111  zebrafish
OPJ66014    30 YGPVFEEQPVHTLFPEGSAEEKVTLACRARASPPATYRWKMNGTELKMEPDSRYRLVAGDLVISNPVKAKDAGSYQCVAS 109 
Feature 1         ####          
1CS6_A      83 NARGTVVSREASLRFGF 99   chicken
2OM5_A      82 NPVGTVVSREAILRFGF 98   human
NP_571521  112 NRCGTIVSRVANLKFGY 128  zebrafish
OPJ66014   110 NSRGTVVSREASLRFGF 126 

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap