Conserved Protein Domain Family
IgI_1_Contactin-1

?
cd05849: IgI_1_Contactin-1 
First immunoglobulin (Ig) domain of contactin-1; member of the I-set of Ig superfamily domains
The members here are composed of the first immunoglobulin (Ig) domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma. This group belongs to the I-set of IgSF domains.
Statistics
?
PSSM-Id: 409436
View PSSM: cd05849
Aligned: 3 rows
Threshold Bit Score: 210.967
Threshold Setting Gi: 116917
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:interdomain interface [polypeptide binding site]
Evidence:
  • Comment:Based on similarity to chicken axonin-1 (contactin-2).
  • Comment:Chicken axonin-1 domains Ig1 and Ig4 interact with each other, helping to form the U shaped structure of the intermolecular binding fragment.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ##                                                                              
Q12860         40 GPIFEEQPINTIYPEESLEGKVSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNN 119  human
P14781         32 GPVFEEQPIDTIYPEESSDGQVSMNCRARAVPFPTYKWKLNNWDIDLTKDRYSMVGGRLVISNPEKSRDAGKYVCVVSNI 111  chicken
NP_001079338   24 GPVFEEQPIDTIFPEESTEGKVSVNCRARGNPPPIYKWRKNNLEIDLLNEHYSLVGGNLVINNPDKYKDSGRYVCIVSNI 103  African clawe...
Feature 1          ####          
Q12860        120 YGMVRSTEATLSFGY 134  human
P14781        112 FGTVRSSEATLSFGY 126  chicken
NP_001079338  104 YGKVWSREATLNFGY 118  African clawed frog

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap