Conserved Protein Domain Family
IgI_1_Contactin-5

?
cd05848: IgI_1_Contactin-5 
First immunoglobulin (Ig) domain of contactin-5; member of the I-set of Ig superfamily domains
The members here are composed of the first immunoglobulin (Ig) domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord. This group belongs to the I-set of IgSF domains.
Statistics
?
PSSM-Id: 409435
View PSSM: cd05848
Aligned: 3 rows
Threshold Bit Score: 206.332
Threshold Setting Gi: 41054217
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:interdomain interface [polypeptide binding site]
Evidence:
  • Comment:Based on similarity to chicken axonin-1 (contactin-2).
  • Comment:Chicken axonin-1 domains Ig1 and Ig4 interact with each other, helping to form the U shaped structure of the intermolecular binding fragment.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ##                                                                              
O94779      98 GPVFVQEPDDIIFPTDSDEKKVALNCEVRGNPVPSYRWLRNGTEIDLESDYRYSLIDGTFIISNPSEAKDSGHYQCLATN 177  human
NP_956098   56 GPVFIQEPDDAIFSLDSDDKKIIMNCEARGNPVPTYSWLINGTNVDTEADFRYSLIDGNLIIHNASEVIDYGRYQCRAEN 135  zebrafish
NP_989943   25 GPVFVQEPDDVIFPTDSEEKKVSLNCQAHGSPTPTYRWLRNGTEIDVESDYRYSLIEGSLIISNPNEMKDSGQYQCLTTN 104  chicken
Feature 1        ####          
O94779     178 TVGSILSREATLQFAY 193  human
NP_956098  136 SIGIVLSRDALLQFAY 151  zebrafish
NP_989943  105 MFGSILSREAVLQFAY 120  chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap