3P40,3P3Y


Conserved Protein Domain Family
IgI_2_L1-CAM_like

?
cd05845: IgI_2_L1-CAM_like 
Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM), and similar domains; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region, and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1 that involves abnormalities of axonal growth. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 409432
View PSSM: cd05845
Aligned: 7 rows
Threshold Bit Score: 167.282
Threshold Setting Gi: 1705571
Created: 11-Jan-2008
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ####                                                                            
3P40_A        120 KENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTI 199  human
3P3Y_A        120 KENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTI 199  human
Q03696        136 KEKVTPVEVEEGDPVVLPCDPPESAVPPKIYWLNSDIVHIAQDERVSMGQDGNLYFSNAMVGDSHPDYICHAHFLGPRTI 215  chicken
P32004        140 KETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIKQDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTI 219  human
XP_414434     136 KEKIEPLDVEHGDSVILHCNPPKGIPPLHIYWMNIDLQHIPQDERVSMSLKGDLYFANVEENDSRSDYCCFAAFPKLRTI 215  chicken
NP_001129635  117 KEMIRPIEVEEGSSLILPCNPPKSAVPPRVIWMNSSLLHITQDKRVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTI 196  African clawe...
O00533        135 KEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTI 214  human
Feature 1                    
3P40_A        200 QQKNPFTLKVL 210  human
3P3Y_A        200 QQKNPFTLKVL 210  human
Q03696        216 IQKEPLDLRVA 226  chicken
P32004        220 IQKEPIDLRVK 230  human
XP_414434     216 VQKMPMTLKVS 226  chicken
NP_001129635  197 VQKEAISIKVR 207  African clawed frog
O00533        215 VQKMPMKLTVN 225  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap