2FUV,2Z0F


Conserved Protein Domain Family
PGM_like3

?
cd05801: PGM_like3 
Click on image for an interactive view with Cn3D
This bacterial PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Statistics
?
PSSM-Id: 100094
View PSSM: cd05801
Aligned: 21 rows
Threshold Bit Score: 900.074
Threshold Setting Gi: 25166381
Created: 4-Nov-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 23 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Based on the structures of Candida albicans AGM1 (N-Acetylglucosamine-phosphate mutase) and Pseudomonas aeruginosa PMM/PGM bound to their substrates and divalent metal ions.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                # #  #                                                 
2FUV_A       23 AQLTAQYYVLKPEAGNAEH--AVKFGTSGHRGSAGRHSFNEPHILAIAQAIAEERAKNGI-TGPCYVGKDTHALSEPAFI 99  Salmonella typhi...
YP_155860    20 AQLTSAYYVYEPDPRKAAE--KVSFGTSGHRGSSLKRSFNEAHILAIAQAICAYREEQGI-TGPIMVAKDTHALSESAYI 96  Idiomarina loihi...
NP_878618    16 TKLIDQYYNLSPDPYNNKEh-KVFFGTSGHRGSSYQYSFNEAHVFAISQSIVQIRTLYGI-TGPCYVAKDTHTLSEPAFI 93  Candidatus Bloch...
ZP_00121508  19 DEVIGKYYDLVPDPEVPEQ--RVIFGTSGHRGSSLKTSFNEAHIIAISQAIAEYRKKAGV-TGPLYLGSDTHALSGPAKK 95  Bifidobacterium ...
YP_277835    20 SRLITQYYTLSPDPSNGAH--NVVFGTSGHRGSSQRYSFNEAHVLAISQSIVQVRAQQGI-SGPCYIGKDTHALSEPAFI 96  Candidatus Bloch...
NP_717926    20 PKLMSHYYSIKPNMDAAEQ--RVTFGTSGHRGTAFQGSFNQDHIWAITQAVVDYRQSVNI-EGPLFLGIDTHALSYAAYV 96  Shewanella oneid...
ZP_01873364  14 DQLLNIDELLLAYTDKKTNlaPVSFGTSGHRGSSLKSSFNETHILAISQAICEYRKSQNI-NGPLYVGIDTHALSKPALI 92  Lentisphaera ara...
YP_748371     3 TTWLNAFYSIQPDTSNPAQ--RVSFGTSGHRGSSLAGSFNELHILAIAQAVVDYCQQADI-SGPLFLGLDTHALSRPAWD 79  Nitrosomonas eut...
YP_824164    28 DRLERTYFERAPEPEDPSQ--MVAFTTAGHRGSPLLGSFTESHVLAITQAICDFRHCVQGtDGPLYMGKDTHALSGPAQR 105 Solibacter usita...
NP_442947    38 AKLLDDYYRQQPDPENPAQ--LVSFGTSGHRGSALNGTFNEAHILAVTQAVVDYRQAQGI-TGPLYMGMDSHALSEPAQK 114 Synechocystis sp...
Feature 1                                                                   ###       #         
2FUV_A      100 SVLEVLAANGVDVIVQEnn---gFTPTPAVSNAILVHNkkg--------gplADGIVITPSHNPPEDGGIKYNPPNGGPA 168 Salmonella typhi...
YP_155860    97 SALDVFIGNGVEVQVQTeh---dYTPTPVLSRAIIEWNren--------takADGVVITPSHNPPEDGGFKYNPSHGGPA 165 Idiomarina loihi...
NP_878618    94 SVLEVLTANSINVIIEKnd---lYTPTPVISNAIINYNrhryh----nnqskADGIIVTSSHNPPEDGGIKYSSIFGGPA 166 Candidatus Bloch...
ZP_00121508  96 TAIEVLVANGVHVRVDSrd---dFVPTPVVSQAILTHNraadgtqrfegeglADGIVVTPSHNPPTDGGFKYDPVTGGPA 172 Bifidobacterium ...
YP_277835    97 SVLEVLAANFVDVIVQKnn---gYTPTPVISHAITQYNknhhn----nhskkADGIIITSSHNPPEDGGIKYNSIYGGPA 169 Candidatus Bloch...
NP_717926    97 SAIEVLAANKVTVYIQQnd---gFTPTPVVSHAIICANhaaaq----ngallSDGLIITPSHNPPQDGGIKYNPPHGGPA 169 Shewanella oneid...
ZP_01873364  93 SCLQVLAANDVEAYYQDdf---gPSPTPVISHAILTWNeen--------kalADGIVITPSHNPPEDGGFKYNSIDGGPA 161 Lentisphaera ara...
YP_748371    80 VVLQVLVANQIAVFVATer---gVTATPLVSRAILAHNaqhp-------tdlADGLIITPSHNPPEDGGIKYNTPDGGPA 149 Nitrosomonas eut...
YP_824164   106 TALEVLAANGVETIIQQdn---gVTPAPVISRAILAYNrtrk-------rglADGIVVSPSHNPPQDGGIRYSAPTGGPP 175 Solibacter usita...
NP_442947   115 TALEVLAANQVETFLTTatdltrFTPTPAVSYAILTHNqgrk-------eglADGIIITPSHNPPTDGGFKYNPPSGGPA 187 Synechocystis sp...
Feature 1                                                                                       
2FUV_A      169 DTNVTKVVEDRANALLAGGLQGVKRisldaaxasghvKAVDLVQPFVEGLADIVDXAAIQKAGLTLGVDPLGGSGIEYWK 248 Salmonella typhi...
YP_155860   166 DSDVTRTIEKYANALLSSGLVGVNTcesedvlqhpklTFVDWRTQYISQLDDCIDMSAIQDAKLRLAVDAMGGSGAKYWT 245 Idiomarina loihi...
NP_878618   167 EIDITYLIEKYANRFLLNNLRTVNKitlnhawrsgyiHPQDLVQNYVQNLSTIINMKAIQKSGLKIGVDPLSGSSINCWY 246 Candidatus Bloch...
ZP_00121508 173 PAETTNAIAARANQLLGDFKSIKRVpyeeai-kseyvEGFDFREHYVDDLENVIDFDVIRNSGVRLGIDPLGGASVNYWP 251 Bifidobacterium ...
YP_277835   170 PTNITRTIEQIANKFLVNNLQHVRRmtlknawksgyiHTQDFIQNYVKKLSTIIDMQAIKTSGLKLGVHPLSGSSIDYWQ 249 Candidatus Bloch...
NP_717926   170 EGNITAWIESRANDYLRAALKGVNKlayadalasgyvHAIDLITPYVADLENVVDMHAIAKANLKLGVDPLGGSGIHYWA 249 Shewanella oneid...
ZP_01873364 162 NTDITTWVENRANDIIANELKDVKKinadqvldsaniKAYDYIPNYVNDLENVIDMQAIKDAKIKIAADPLGGASLPYWE 241 Lentisphaera ara...
YP_748371   150 DSDVTDWIEARANQYLQKQCAEVKRmdlqd--alsqvQEYNYVAHYVAELGQVVDLPAIRQSGLKLGVDPMGGTGLPVWQ 227 Nitrosomonas eut...
YP_824164   176 DADTAHWLETRANDLLREGNVDVHRvpvlagllaattHHEDLVMPYVRDLVSVLDMDAIKAAHIGLAVDPLGGAALPYWE 255 Solibacter usita...
NP_442947   188 EPEATQWIQNRANELLKNGNKTVKRldyeqalkatttHAHDFVTPYVAGLADIIDLDVIRSAGLRLGVDPLGGANVGYWE 267 Synechocystis sp...
Feature 1                                                                      # # ##           
2FUV_A      249 RIAEHYKLNLTLVNDQVDQTFRFXHLDKDGAIRXDCSSECAXAGLLALRd-----kFDLAFANDPDYDRHGIVTp-aGLX 322 Salmonella typhi...
YP_155860   246 QIAEHYNLSIEVRNAVVDPTFSFMPLDKDGKIRMDCSSPFAMASLLELKd-----nYDLAFGNDPDYDRHGIVTpthGLL 320 Idiomarina loihi...
NP_878618   247 DIAQYYQLNLTVINSKIDRTFSFMNIDYDGRIRINCTSELTLSKVLSSSk-----kFDLFFINDPDCDRHGIITk-gGLI 320 Candidatus Bloch...
ZP_00121508 252 LINEKYGLNIGVVRPEVDPTWRFMTIDHDGKIRMDPSSPYAMKGLVDELnagawdkYDLVGGTDPDADRHGIVCpnwGVM 331 Bifidobacterium ...
YP_277835   250 NIAQFYQLDLNLISEKIDKTFGFIHLDYDGCIRLDCSSEFAMAGVLKSHd-----nFDLLLVNDPDCDRHGIITp-iGLI 323 Candidatus Bloch...
NP_717926   250 PIAKHYGIDITLVNDKVDPSFSFMSLDKDGKIRMDCSSPYAMAGLLAHKe-----sFDLCVGNDPDYDRHGIVCpgtGLM 324 Shewanella oneid...
ZP_01873364 242 PIVEKYGLDITVVNDSVDPTFKFMTCDRDGKIRMDCSSPWAMSSLIKLKd-----qYDIAFGNDPDSDRHGIVTrssGLL 316 Lentisphaera ara...
YP_748371   228 ALALDPAFNITVVNTSQAADFAFMPPDHDGRIRMDCSSPAAMANLLKIRq-----qFDLSLANDPDADRHGIVDa-aGLM 301 Nitrosomonas eut...
YP_824164   256 PIADLYGLDLTILNPVIDPSFAFMTVDHDGLIRMDCSSPFALTQLVALKd-----rYSLSFANDPDADSHAVVTpgaGLL 330 Solibacter usita...
NP_442947   268 PIAAKYNLNISLVNPGVDPTFKFMTLDWDGKIRMDCSSPYAMASLVKIKd-----hYDIAFGNDTDGDRHGIVTpsvGLM 342 Synechocystis sp...
Feature 1                                       #                    ###                # # #   
2FUV_A      323 NPNHYLAVAINYLFQ-HRPlWGk-DVAVGKTLVSSAXIDRVVNDLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASF 400 Salmonella typhi...
YP_155860   321 NPNHYLSVAIDYLCK-NRD-WDs-SIAIGKTLVSSAMIDRVVGANERPLMEVPVGFKWFAKGLFERSIAFAGEESAGATL 397 Idiomarina loihi...
NP_878618   321 QSNYYFPIVINYLFH-NRDfWKkkILSVGKTNVSSMSIDQVANNLNCQLLTTPVGFKWFTQGLLHSKLGFAGEDSSGASF 399 Candidatus Bloch...
ZP_00121508 332 NPNHYIAVCVEYLFGgNRPgWPe-GAAVGKTLVSSSLIDRVAASINAKVIEVPVGFKWFVDPLFSGEVAFGGEESSGMSF 410 Bifidobacterium ...
YP_277835   324 KPNHYLIIAAHYLFN-NRPlWRnrSLFIGKTYVSSIMMNHVAYDLSRQLIEVPVGFKWFVRGLFNSLFGFVGEESAGASF 402 Candidatus Bloch...
NP_717926   325 DPNHYLAVAIDYLLT-HRPeWSd-SLAIGKTLVSSALIDKICVFHGKKLLEVPVGFKWFVDGLAEATIAFGGEESAGAAF 402 Shewanella oneid...
ZP_01873364 317 NPNHYLSVAIKYLYE-NRTeWNq-NLEVGKTLVSSSMIDKVGSEIKRTICEVPVGFKWFVDGLVSQKIAFGGEESAGASF 394 Lentisphaera ara...
YP_748371   302 NPNHFLCVCVDYLLT-YRPlWSk-SLKIGKTLVTSSLMDRIVAAHDRELYEVPVGFKWFVKGLHQSWLAFAGEESAGASL 379 Nitrosomonas eut...
YP_824164   331 PPNHYLAVSIQYLLA-HRShWHr-RAGVGKTLLASSIIDRIVRKLGGRLCEVPPGFEWLAPGISDGSFSFGCDENAGATF 408 Solibacter usita...
NP_442947   343 NPNHFLSVAIWYLFS-QRQqWSg-LSAIGKTLVSSSMIDRVGAMINRQVYEVPVGFKWFVSGLLDGSFGFGGEESAGASF 420 Synechocystis sp...
Feature 1                                                                                       
2FUV_A      401 LRFDGTPWSTDKDGIIXCLLAAEITAVTgKNPQEHYNELAARFGa-pSYNRLQASATSAQKAALSKLSPEXVSASTLAGD 479 Salmonella typhi...
YP_155860   398 LDRKGNTWTTDKDGIVMALLAAEILTKTgKNPGQYYDDLCQQHGt-aYYRRVDTASSVQKNARFKDIRAYKVKLPELAGD 476 Idiomarina loihi...
NP_878618   400 LDQRCMPWSTDKDGFIMCLISAEILAVTdHTLQDHHIQFNKNLNctfNYNQTYLVINHSQKKSIINTLFNQIHMNELVGD 479 Candidatus Bloch...
ZP_00121508 411 LRKDGRVWTTDKDGLIPDLLAAEITAKTgKNPAQLHQEQVERFGe-sWYKRVDTPTTLEQKAKFAALSGDDVTASTLAGE 489 Bifidobacterium ...
YP_277835   403 LDFYCSPWSTDKDGLIMCLLAAEMIAISdKSLQKYYDQLVQNFGi-sNYNRIQLPINYTQKSIISNTLFNQINMTELADD 481 Candidatus Bloch...
NP_717926   403 LRRDGTTWCTDKDGFILVLLAAEMLAVTgKTPGQRHQELVAQFGq-sFYKRIDSPISLENKAKFAKLNADTLNATMLAGE 481 Shewanella oneid...
ZP_01873364 395 LRKNGKVWTTDKDGIILCLLAAEILAVTkKDPGQLYQELTETHGa-pIYARIDAAASPEQKDKLKKLSPEDISATSVAGF 473 Lentisphaera ara...
YP_748371   380 LTFDGQTWTTDKDGIALCLLAAEISAVTgLTPSQYYAKLTEQYGr-pYYRRIDAPATAEQKAVFKTLTVAHITATELAGE 458 Nitrosomonas eut...
YP_824164   409 LQHDDTAWTTGKDGLVMNLLAAEIAARTgRDPGELYSMVAAEVGp-hWYSRTEAPAAPQQKTKLVRLGPAAVRQSHLAGQ 487 Solibacter usita...
NP_442947   421 LKKNGTVWTTDKDGTIMDLLAAEITAKTgKDPGLHYQDLTAKLGn-pIYQRIDAPATPAQKDRLKKLSPDDVTATSLAGD 499 Synechocystis sp...
Feature 1                                      # ###    #                       
2FUV_A      480 PITARLtaapg-ngasIGGLKVXTDNGWFAARPSGTEDAYKIYCESFLgeEHRKQIEKEAVEIV 542 Salmonella typhimurium
YP_155860   477 SVSDIStkaag-ndaqFGGIKVTTDNGWFAARPSGTEPVYKIYAESFVseQHLDDILEQATTWV 539 Idiomarina loihiensis L2TR
NP_878618   480 PIIKVEnikplnkfisMDGLKIVTRNGWIAGRLSGTELVYKIYCESFLssDHRLKMEQKMIRCI 543 Candidatus Blochmannia floridanus
ZP_00121508 490 DITAKLteapg-nhakIGGLKVTTKDNWFAARPSGTENIYKVYAESFVspEALDKVLDEATVVV 552 Bifidobacterium longum DJO10A
YP_277835   482 PITKIInmsslknqisMDGVKIITHNGWVACRLSGTESVYKIYCESFLsvSHRKKIEKEIISII 545 Candidatus Blochmannia pennsylva...
NP_717926   482 KIEAVLthapg-nnasIGGIKVTTTNGWFAARPSGTEALFKIYGESFIseQHLAEIIKDAQALI 544 Shewanella oneidensis MR-1
ZP_01873364 474 PILEKLshasg-ngaaIGGLKVTTESGWFAARPSGTEDIYKIYAESFIseEHLKELQKDAQEIV 536 Lentisphaera araneosa HTCC2155
YP_748371   459 PIELVLlnapg-ngasIGGIKVCTENGWFAARPSGTEALYKIYAESFIseQHLQQLIDEGQTLL 521 Nitrosomonas eutropha C91
YP_824164   488 PILAKLnrapg-nnapIGGLKVVAASGWFAAYPSNSENLYRIYAESFEsqEHLDQIQGEAREIV 550 Solibacter usitatus Ellin6076
NP_442947   500 AITAKLtkapg-nqaaIGGLKVTTAEGWFAARPSGTENVYKIYAESFKdeAHLQAIFTEAEAIV 562 Synechocystis sp. PCC 6803

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap