Conserved Protein Domain Family
DNA_polB_alpha_exo

?
cd05776: DNA_polB_alpha_exo 
inactive DEDDy 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha, a family-B DNA polymerase
The 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha. DNA polymerase alpha is a family-B DNA polymerase with a catalytic subunit that contains a DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (delta and epsilon are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase alpha is almost exclusively required for the initiation of DNA replication and the priming of Okazaki fragments during elongation. It associates with DNA primase and is the only enzyme able to start DNA synthesis de novo. The catalytic subunit contains both polymerase and 3'-5' exonuclease domains, but only exhibits polymerase activity. The 3'-5' exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, without the four conserved acidic residues that are crucial for metal binding and catalysis. This explains why in most organisms, that no specific repair role, other than check point control, has been assigned to this enzyme. The exonuclease domain may have a structural role.
Statistics
?
PSSM-Id: 99819
View PSSM: cd05776
Aligned: 48 rows
Threshold Bit Score: 167.404
Threshold Setting Gi: 154418827
Created: 1-Oct-2007
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P33609        539 PPLVVMSFSMKTMQNVqnhqhEIIAMAALVHHSFALDKAPPEPpfqthfcvvskpkdc---------------------- 596  house mouse
XP_657373     321 PPLNICSIETICLNEEkt--kKPMMISLDVVKSVPMSHSMKAWrddvytfy----------------------------- 369  Entamoeba his...
EAU90184      516 PPFTVMSLSVRTVVNHhenkrEVVCASTRTWHNISIDDGTPPEqlpcsvqtfiraldr---------------------- 573  Coprinopsis c...
EAA33895      541 PPLTLLSLAMRTAFNPkdnkqEILAVSGRVYLDVSLSDTTPPDklasrsftavrpygsa--------------------- 599  Neurospora cr...
EAT84659      533 PPMTLMSLSLRTSFNAkenkqEILMASAMVYDNFSLSDTTPIDqmqaksftlmrpngt---------------------- 590  Phaeosphaeria...
BAE65042      534 PPLTLMSLAFRTQLNVkenkqEILIASARVYENVSLTDTTPPEklpcktftvmrpvgs---------------------- 591  Aspergillus o...
P28040        522 PPMTVMSLAFRTLINKeqnkqEVVMISARIFENVDIEKGLPANdmpsysfslirplkq---------------------- 579  fission yeast
XP_001306852  411 PEFNLACISVKTEYDNtkkehVIRMISLRVFAKCAITKLSSNDchkatyywm---------------------------- 462  Trichomonas v...
XP_001582431  295 PPLNVCVISIGTYFNEekkthEIYLLNVRVFMNHKFHKYQDNIvhtfitspspdiklrteliftnlksdksrhhsksdks 374  Trichomonas v...
EDP41480      485 PPLTIMSLALRTVVNYkenkrEIVAVSARVWRDMALENPTPPEqlpsssftavrplga---------------------- 542  Malassezia gl...
P33609            --------------------------------------------------------------------------------      house mouse
XP_657373         --------------------------------------------------------------------------------      Entamoeba his...
EAU90184          --------------------------------------------------------------------------------      Coprinopsis c...
EAA33895          --------------------------------------------------------------------------------      Neurospora cr...
EAT84659          --------------------------------------------------------------------------------      Phaeosphaeria...
BAE65042          --------------------------------------------------------------------------------      Aspergillus o...
P28040            --------------------------------------------------------------------------------      fission yeast
XP_001306852      --------------------------------------------------------------------------------      Trichomonas v...
XP_001582431  375 kntnkhkeksknsksdntnkneeishisksdinksdkakasdtknqneekhkipksdtnksdkdkgekvndeifvgnetk 454  Trichomonas v...
EDP41480          --------------------------------------------------------------------------------      Malassezia gl...
P33609        597 ----------------------ifpcdfkeviskknmKVEIAATERTLIGFFLAKVHKIDPDILVGHNIcSFELEVLLQR 654  house mouse
XP_657373     370 -----------------------------inqgvkcsKGMEAKDQRELLLKVCNFIQQHDIDLIISHDM-TTTLMPFFDI 419  Entamoeba his...
EAU90184      574 ----------------------fppnfesetkkktrgQILPTQNERMLLSLLLAAINKSDPDIIIGHEFlGVSLDVLLHR 631  Coprinopsis c...
EAA33895      600 ----------------------fpigfetlakernrgVLKLFKQEHEILNFLLAQIDVVDPDVILGHQLeGVDYSILLNR 657  Neurospora cr...
EAT84659      591 ----------------------afptgfqaeaaklkgNTKFVKTEQELLSLLMAMFQRHDPDVLMGHRLdDVDYSVLLNR 648  Phaeosphaeria...
BAE65042      592 ----------------------sypmhfeaetkrqrgTYILERSEQFLLSKFLALFEKMDPDVLMGHQLqEVDLSILLNR 649  Aspergillus o...
P28040        580 ----------------------ifpngfeklarqhksSIFCERSEVSLLNNFLNKVRTYDPDVYFGHDF-EMCYSVLLSR 636  fission yeast
XP_001306852  463 ----------------------------lgniknselPGTPFNNEKDMLERFITDIQNSDIDLILSFGFnTFDGQIIAQR 514  Trichomonas v...
XP_001582431  455 cdkfkddktqtrevlleaeeyvepkqedtklnanlseRVTFYSSEKKLLKNFVRLIDKLDIDILASYTMfTNDIQVIFDR 534  Trichomonas v...
EDP41480      543 ----------------------sfpprfeeqaaqgknKIKAFKFERMVLNSLLGQIQWHDADVILSHDFvGSTMDTLLHR 600  Malassezia gl...
P33609        655 INECKVp-yWSKIGRLRRSNmpklgs---rsgfgERNATCGRMICDVEISA-KELIh-cKSYHLSELVQQILKt--ERIV 726  house mouse
XP_657373     420 IESSGEvsaYSKFGRLKRTLtnikskdnkdgtfaGKTFFSGRLLADTFVLS-KEFLkseKINDLNTLTSHYLGi--QREY 496  Entamoeba his...
EAU90184      632 MKDLKVd-hWSRLGRFRRSKwpnig-----kqgtNVRFLNGRLTCDLASDAaKSMIs-sTTWSLTEMCSTHLGl--ERQD 702  Coprinopsis c...
EAA33895      658 LHEKKTh-qWSRLGRLRRSQwpssivkmggnvfaERQIMSGRLLCDLANDAgKSVMtkcQTWSLTEMCSLYLGgesRRRD 736  Neurospora cr...
EAT84659      649 LREKKTp-gWHRIGRVKRSDwpknlgkgggsffaEKQLASGRLLCDLANDLgKSLMtkcQSWSLEEMCQLVLNq--RREE 725  Phaeosphaeria...
BAE65042      650 LKEKKTp-gWHRLGRLKRGDwpknfnr-gggffaERHLIAGRLMCDVANDMgKSLMmkcQSWSLTEMCNLYLGpgnVRQE 727  Aspergillus o...
P28040        637 LKERKIh-nWSSIGRLRRSEwprsfnr-ssqqfvEKQIIAGRLMCDLSNDFgRSMIk-aQSWSLSEIVLKELDi--KRQD 711  fission yeast
XP_001306852  515 LIQLKVk-dWYRIGRLKRSFprdnit---kfsknTLLILSGRLPVDIRVSA-DEFLh-sKANDFASVIQQELGi--LVPD 586  Trichomonas v...
XP_001582431  535 MKTLNVe-eWFRIGRLNRSTqikt------skynASFCLSGRIAVDIRTNL-REFLn-lPANDLSSVSLQEFGi--KRQQ 603  Trichomonas v...
EDP41480      601 MRDLKCe-nWTRLGRMRQDVskmvkq---slhalHTRMLVGRLVADLSSDTaKGMIp-sTTWSLSEMCRTHLNa--QRED 673  Malassezia gl...
P33609        727 IPTeNIRNMYse------sSYLLYLLEHIWKDARFILQIMCELNVLPLALQ 771  house mouse
XP_657373     497 NID-DLTCSSdielalqdkNKIESIRNYLEENSRLVIKLCNQMNAIAMTKE 546  Entamoeba histolytica HM-1:IMSS
EAU90184      703 IDPdDTANYLdgsl--sgpGKMMTFVQHCEMDAHYQMAIATKVQILPLTRQ 751  Coprinopsis cinerea okayama7#130
EAA33895      737 IDNeVALKTWana----dkHGLMDYISHAETDTYFIAALALRTQILPLTKV 783  Neurospora crassa OR74A
EAT84659      726 LDNeAALKSWat-----tkEGLLNYVKHCQADAYFIAAISMKVQMLPLTKV 771  Phaeosphaeria nodorum SN15
BAE65042      728 LDGeAALKTWat-----tkDGLMNFVNHCDTDTYFVAALVLRLQMLPLTKV 773  Aspergillus oryzae
P28040        712 INQeKALQSWtd-----taHGLLDYLVHCEIDTFFIAAVAFKIQMLQLSKN 757  fission yeast
XP_001306852  587 LET-SNFSQLif-----niPMLKKYVIANENNTAYIINLTRKIHIVPLTLQ 631  Trichomonas vaginalis G3
XP_001582431  604 IENvDILKEInd------rNKVISLIEFFERDTNILTKLMEKTNLLEITFR 648  Trichomonas vaginalis G3
EDP41480      674 IDPeDVASFFdcta--ptpERLLTFVRHCEVDAFFQMAMACKMQLLALTKQ 722  Malassezia globosa CBS 7966
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap