Conserved Protein Domain Family
IgC1_hNephrin_like

?
cd05773: IgC1_hNephrin_like 
Immunoglobulin-like domain of human nephrin and similar proteins; member of the C1-set of Ig superfamily (IgSF) domains
The members here are composed of the immunoglobulin-like domain in human nephrin and similar proteins. Nephrin is an integral component of the slit diaphragm and is a central component of the glomerular ultrafilter. Nephrin plays a structural role and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin from neighboring foot processes of separate podocyte cells may interact with each other, and in association with other components of the slit diaphragm form a porous molecular sieve within the slit pore. The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the podocytes.
Statistics
?
PSSM-Id: 143250
View PSSM: cd05773
Aligned: 3 rows
Threshold Bit Score: 213.253
Threshold Setting Gi: 147906053
Created: 17-Aug-2007
Updated: 17-Aug-2020
Structure
?
Aligned Rows:
  next features
Feature 1:dimer interface [polypeptide binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1          ####                     # # # #                               #### # ##       
O60500        834 VRFAPQVEHPTPLTKVAAAGDSTSSATLHCRARGVPNIVFTWTKNGVPLDLQDPRYTEHTYHQGGVHSSLLTIANVSAAQ 913  human
NP_001089175  814 VRFKPDIHKGVHLSKVAVPGDGKSVAALVCKAEGIPSVAFSWAKNGVSLDLKGPRYSEKTFHELSVHTSTLVISNVSAVK 893  African clawe...
NP_001035777  814 VRFAPDLQKGPQWRKVASRGDGSNDANVVCQAQGVPRVQFRWAKNGFPLDLGNPRYEETTESTGTIHTSILTVINVSAAL 893  zebrafish
Feature 1                         ###          
O60500        914 DYALFTCTATNALGSDQTNIQLVSISRPD 942  human
NP_001089175  894 DYALFTCTAMNTLGVDSFSIQLVSTSRPD 922  African clawed frog
NP_001035777  894 DYAIFTCTAHNSMGEDSLDIQLLSTNHPD 922  zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap